Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2409461..2409645 | Replicon | chromosome |
| Accession | NC_022222 | ||
| Organism | Staphylococcus aureus subsp. aureus 6850 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | RSAU_RS12165 | Protein ID | WP_000482647.1 |
| Coordinates | 2409538..2409645 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2409461..2409521 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RSAU_RS12145 | 2404971..2405138 | - | 168 | WP_001789205.1 | hypothetical protein | - |
| RSAU_RS12155 | 2405369..2407102 | - | 1734 | WP_020977552.1 | ABC transporter ATP-binding protein/permease | - |
| RSAU_RS12160 | 2407127..2408890 | - | 1764 | WP_001064822.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2409461..2409521 | + | 61 | - | - | Antitoxin |
| RSAU_RS12165 | 2409538..2409645 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| RSAU_RS12170 | 2409779..2410165 | - | 387 | WP_000779353.1 | flippase GtxA | - |
| RSAU_RS12175 | 2410433..2411575 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| RSAU_RS12180 | 2411635..2412294 | + | 660 | WP_000831298.1 | membrane protein | - |
| RSAU_RS12185 | 2412477..2413688 | + | 1212 | WP_001191921.1 | multidrug effflux MFS transporter | - |
| RSAU_RS12190 | 2413811..2414284 | - | 474 | WP_020977553.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T29962 WP_000482647.1 NC_022222:c2409645-2409538 [Staphylococcus aureus subsp. aureus 6850]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T29962 NC_022222:c2409645-2409538 [Staphylococcus aureus subsp. aureus 6850]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT29962 NC_022222:2409461-2409521 [Staphylococcus aureus subsp. aureus 6850]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|