Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2116805..2117022 | Replicon | chromosome |
| Accession | NC_022222 | ||
| Organism | Staphylococcus aureus subsp. aureus 6850 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | RSAU_RS10615 | Protein ID | WP_001802298.1 |
| Coordinates | 2116918..2117022 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2116805..2116860 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RSAU_RS10595 | 2112938..2113603 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
| RSAU_RS10600 | 2113755..2114075 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| RSAU_RS10605 | 2114077..2115054 | + | 978 | WP_000019732.1 | CDF family zinc efflux transporter CzrB | - |
| RSAU_RS10610 | 2115320..2116411 | + | 1092 | WP_020977458.1 | hypothetical protein | - |
| - | 2116805..2116860 | + | 56 | - | - | Antitoxin |
| RSAU_RS10615 | 2116918..2117022 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| RSAU_RS14605 | 2117183..2117686 | - | 504 | Protein_2007 | recombinase family protein | - |
| RSAU_RS10625 | 2117734..2119026 | + | 1293 | WP_020977460.1 | IS21 family transposase | - |
| RSAU_RS10630 | 2119019..2119780 | + | 762 | WP_001066124.1 | IS21-like element helper ATPase IstB | - |
| RSAU_RS14685 | 2119916..2121052 | - | 1137 | Protein_2010 | SAP domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2119016..2119780 | 764 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T29959 WP_001802298.1 NC_022222:c2117022-2116918 [Staphylococcus aureus subsp. aureus 6850]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T29959 NC_022222:c2117022-2116918 [Staphylococcus aureus subsp. aureus 6850]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT29959 NC_022222:2116805-2116860 [Staphylococcus aureus subsp. aureus 6850]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|