Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1805125..1805305 | Replicon | chromosome |
Accession | NC_022222 | ||
Organism | Staphylococcus aureus subsp. aureus 6850 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | RSAU_RS14565 | Protein ID | WP_001801861.1 |
Coordinates | 1805125..1805220 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1805248..1805305 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RSAU_RS08795 | 1800592..1801587 | + | 996 | WP_020977362.1 | DUF4352 domain-containing protein | - |
RSAU_RS08800 | 1801663..1802289 | + | 627 | WP_000669045.1 | hypothetical protein | - |
RSAU_RS08805 | 1802330..1802671 | + | 342 | WP_000627534.1 | DUF3969 family protein | - |
RSAU_RS08810 | 1802772..1803344 | + | 573 | WP_000414218.1 | hypothetical protein | - |
RSAU_RS08815 | 1803674..1803859 | - | 186 | WP_000809860.1 | hypothetical protein | - |
RSAU_RS08820 | 1803861..1804037 | - | 177 | WP_000375478.1 | hypothetical protein | - |
RSAU_RS08825 | 1804048..1804337 | - | 290 | Protein_1697 | hypothetical protein | - |
RSAU_RS08830 | 1804505..1804738 | - | 234 | Protein_1698 | IS3 family transposase | - |
RSAU_RS08835 | 1804744..1804980 | - | 237 | WP_000251969.1 | IS3 family transposase | - |
RSAU_RS14565 | 1805125..1805220 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1805248..1805305 | - | 58 | - | - | Antitoxin |
RSAU_RS08840 | 1806161..1806604 | - | 444 | WP_000728661.1 | DUF1433 domain-containing protein | - |
RSAU_RS08845 | 1806604..1807047 | - | 444 | WP_000731420.1 | DUF1433 domain-containing protein | - |
RSAU_RS08850 | 1807047..1807490 | - | 444 | WP_000747798.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1804744..1804980 | 236 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T29953 WP_001801861.1 NC_022222:1805125-1805220 [Staphylococcus aureus subsp. aureus 6850]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T29953 NC_022222:1805125-1805220 [Staphylococcus aureus subsp. aureus 6850]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT29953 NC_022222:c1805305-1805248 [Staphylococcus aureus subsp. aureus 6850]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|