Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2444326..2444510 | Replicon | chromosome |
| Accession | NC_022113 | ||
| Organism | Staphylococcus aureus subsp. aureus 55/2053 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | - |
| Locus tag | SAAG_RS12395 | Protein ID | WP_000482648.1 |
| Coordinates | 2444403..2444510 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2444326..2444386 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAAG_RS12370 | 2439836..2440003 | - | 168 | Protein_2357 | hypothetical protein | - |
| SAAG_RS12380 | 2440234..2441967 | - | 1734 | WP_000486505.1 | ABC transporter ATP-binding protein/permease | - |
| SAAG_RS12385 | 2441992..2443755 | - | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2444326..2444386 | + | 61 | - | - | Antitoxin |
| SAAG_RS12395 | 2444403..2444510 | - | 108 | WP_000482648.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| SAAG_RS12400 | 2444644..2445030 | - | 387 | WP_000779351.1 | flippase GtxA | - |
| SAAG_RS12405 | 2445298..2446440 | + | 1143 | WP_001176855.1 | glycerate kinase | - |
| SAAG_RS12410 | 2446500..2447159 | + | 660 | WP_000831298.1 | membrane protein | - |
| SAAG_RS12415 | 2447341..2448552 | + | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
| SAAG_RS12420 | 2448675..2449148 | - | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4026.79 Da Isoelectric Point: 10.4935
>T29935 WP_000482648.1 NC_022113:c2444510-2444403 [Staphylococcus aureus subsp. aureus 55/2053]
MFNLLIEIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIEIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T29935 NC_022113:c2444510-2444403 [Staphylococcus aureus subsp. aureus 55/2053]
ATGTTCAATTTATTAATTGAAATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGAAATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT29935 NC_022113:2444326-2444386 [Staphylococcus aureus subsp. aureus 55/2053]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|