Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 1983078..1983377 | Replicon | chromosome |
| Accession | NC_022113 | ||
| Organism | Staphylococcus aureus subsp. aureus 55/2053 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | SAAG_RS14555 | Protein ID | WP_011447039.1 |
| Coordinates | 1983201..1983377 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 1983078..1983133 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAAG_RS09825 | 1978412..1978672 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| SAAG_RS09830 | 1978725..1979075 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| SAAG_RS09835 | 1979758..1980207 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| SAAG_RS09840 | 1980302..1980636 | - | 335 | Protein_1874 | SH3 domain-containing protein | - |
| SAAG_RS09845 | 1981286..1981777 | - | 492 | WP_000919350.1 | staphylokinase | - |
| SAAG_RS09850 | 1981968..1982723 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| SAAG_RS09855 | 1982735..1982989 | - | 255 | WP_000611512.1 | phage holin | - |
| SAAG_RS09860 | 1983041..1983148 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 1983070..1983209 | + | 140 | NuclAT_0 | - | - |
| - | 1983070..1983209 | + | 140 | NuclAT_0 | - | - |
| - | 1983070..1983209 | + | 140 | NuclAT_0 | - | - |
| - | 1983070..1983209 | + | 140 | NuclAT_0 | - | - |
| - | 1983078..1983133 | + | 56 | - | - | Antitoxin |
| SAAG_RS14555 | 1983201..1983377 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| SAAG_RS09870 | 1983527..1983823 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| SAAG_RS09875 | 1983881..1984168 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| SAAG_RS09880 | 1984215..1984367 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| SAAG_RS09885 | 1984357..1988142 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 1978725..2034925 | 56200 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T29928 WP_011447039.1 NC_022113:c1983377-1983201 [Staphylococcus aureus subsp. aureus 55/2053]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T29928 NC_022113:c1983377-1983201 [Staphylococcus aureus subsp. aureus 55/2053]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT29928 NC_022113:1983078-1983133 [Staphylococcus aureus subsp. aureus 55/2053]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|