Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 94283..94537 | Replicon | plasmid P1 |
| Accession | NZ_OY019089 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 42 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QU406_RS25900 | Protein ID | WP_001312851.1 |
| Coordinates | 94283..94432 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 94476..94537 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QU406_RS25870 (89530) | 89530..90441 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| QU406_RS25875 (90452) | 90452..91672 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| QU406_RS25880 (92379) | 92379..92993 | + | 615 | Protein_105 | VENN motif pre-toxin domain-containing protein | - |
| QU406_RS25885 (92993) | 92993..93439 | - | 447 | Protein_106 | plasmid replication initiator RepA | - |
| QU406_RS25890 (93432) | 93432..93506 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| QU406_RS25895 (93742) | 93742..93999 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| QU406_RS25900 (94283) | 94283..94432 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (94476) | 94476..94537 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (94476) | 94476..94537 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (94476) | 94476..94537 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (94476) | 94476..94537 | + | 62 | NuclAT_2 | - | Antitoxin |
| QU406_RS25905 (94676) | 94676..94858 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| QU406_RS25910 (94959) | 94959..95575 | + | 617 | Protein_111 | IS1-like element IS1A family transposase | - |
| QU406_RS25915 (95613) | 95613..97184 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| QU406_RS25920 (97204) | 97204..97551 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QU406_RS25925 (97551) | 97551..98228 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| QU406_RS25930 (98283) | 98283..98372 | + | 90 | Protein_115 | IS1 family transposase | - |
| QU406_RS25935 (98673) | 98673..98885 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / tet(A) | senB / iucD / iutA | 1..168227 | 168227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T297218 WP_001312851.1 NZ_OY019089:c94432-94283 [Escherichia coli O25b:H4-ST131]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT297218 NZ_OY019089:94476-94537 [Escherichia coli O25b:H4-ST131]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
