Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 5086472..5086693 | Replicon | chromosome |
Accession | NZ_OY019088 | ||
Organism | Escherichia coli O25b:H4-ST131 isolate 42 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A1U9U3P9 |
Locus tag | QU406_RS24910 | Protein ID | WP_001531632.1 |
Coordinates | 5086472..5086579 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 5086627..5086693 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QU406_RS24885 (5082316) | 5082316..5083398 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
QU406_RS24890 (5083398) | 5083398..5084231 | + | 834 | WP_000456450.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
QU406_RS24895 (5084228) | 5084228..5084620 | + | 393 | WP_000200375.1 | invasion regulator SirB2 | - |
QU406_RS24900 (5084624) | 5084624..5085433 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
QU406_RS24905 (5085469) | 5085469..5086323 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
QU406_RS24910 (5086472) | 5086472..5086579 | - | 108 | WP_001531632.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_12 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_12 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_12 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_12 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_13 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_13 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_13 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_13 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_14 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_14 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_14 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_14 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_15 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_15 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_15 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_15 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_16 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_16 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_16 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_16 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_17 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_17 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_17 | - | - |
- (5086629) | 5086629..5086692 | + | 64 | NuclAT_17 | - | - |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_10 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_10 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_10 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_10 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_5 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_5 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_5 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_5 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_6 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_6 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_6 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_6 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_7 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_7 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_7 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_7 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_8 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_8 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_8 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_8 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_9 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_9 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_9 | - | Antitoxin |
- (5086627) | 5086627..5086693 | + | 67 | NuclAT_9 | - | Antitoxin |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_18 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_18 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_18 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_18 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_19 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_19 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_19 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_19 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_20 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_20 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_20 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_20 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_21 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_21 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_21 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_21 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_22 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_22 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_22 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_22 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_23 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_23 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_23 | - | - |
- (5086629) | 5086629..5086694 | + | 66 | NuclAT_23 | - | - |
QU406_RS24915 (5086984) | 5086984..5088084 | - | 1101 | WP_000063608.1 | sodium-potassium/proton antiporter ChaA | - |
QU406_RS24920 (5088354) | 5088354..5088593 | + | 240 | WP_000120702.1 | putative cation transport regulator ChaB | - |
QU406_RS24925 (5088742) | 5088742..5089437 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
QU406_RS24930 (5089481) | 5089481..5089834 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
QU406_RS24935 (5090019) | 5090019..5091413 | + | 1395 | WP_000086187.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4040.89 Da Isoelectric Point: 12.5163
>T297214 WP_001531632.1 NZ_OY019088:c5086579-5086472 [Escherichia coli O25b:H4-ST131]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT297214 NZ_OY019088:5086627-5086693 [Escherichia coli O25b:H4-ST131]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|