Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2929435..2930037 | Replicon | chromosome |
| Accession | NZ_OY019088 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 42 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QU406_RS14315 | Protein ID | WP_000897302.1 |
| Coordinates | 2929435..2929746 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QU406_RS14320 | Protein ID | WP_000356397.1 |
| Coordinates | 2929747..2930037 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QU406_RS14290 (2925349) | 2925349..2925948 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
| QU406_RS14295 (2925942) | 2925942..2926814 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QU406_RS14300 (2926811) | 2926811..2927248 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| QU406_RS14305 (2927293) | 2927293..2928234 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QU406_RS14310 (2928298) | 2928298..2929206 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| QU406_RS14315 (2929435) | 2929435..2929746 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QU406_RS14320 (2929747) | 2929747..2930037 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QU406_RS14325 (2930122) | 2930122..2930334 | + | 213 | WP_000197774.1 | hypothetical protein | - |
| QU406_RS14330 (2930396) | 2930396..2930674 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| QU406_RS14335 (2931071) | 2931071..2931289 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| QU406_RS14340 (2931474) | 2931474..2932214 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| QU406_RS14345 (2932239) | 2932239..2933087 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| QU406_RS14350 (2933377) | 2933377..2933619 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| QU406_RS14355 (2933801) | 2933801..2934730 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T297205 WP_000897302.1 NZ_OY019088:2929435-2929746 [Escherichia coli O25b:H4-ST131]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|