Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2118749..2119548 | Replicon | chromosome |
Accession | NZ_OY019088 | ||
Organism | Escherichia coli O25b:H4-ST131 isolate 42 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | QU406_RS10350 | Protein ID | WP_000347251.1 |
Coordinates | 2119084..2119548 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | QU406_RS10345 | Protein ID | WP_001296435.1 |
Coordinates | 2118749..2119084 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QU406_RS10330 (2114534) | 2114534..2115304 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
QU406_RS10335 (2115320) | 2115320..2116654 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
QU406_RS10340 (2117029) | 2117029..2118600 | + | 1572 | WP_001273763.1 | galactarate dehydratase | - |
QU406_RS10345 (2118749) | 2118749..2119084 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QU406_RS10350 (2119084) | 2119084..2119548 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QU406_RS10355 (2119603) | 2119603..2120412 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QU406_RS10360 (2120661) | 2120661..2121941 | + | 1281 | WP_000681950.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QU406_RS10365 (2121964) | 2121964..2122437 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QU406_RS10370 (2122448) | 2122448..2123227 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QU406_RS10375 (2123217) | 2123217..2124095 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QU406_RS10380 (2124113) | 2124113..2124547 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T297203 WP_000347251.1 NZ_OY019088:2119084-2119548 [Escherichia coli O25b:H4-ST131]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Download Length: 112 a.a. Molecular weight: 12321.92 Da Isoelectric Point: 4.5392
>AT297203 WP_001296435.1 NZ_OY019088:2118749-2119084 [Escherichia coli O25b:H4-ST131]
MPANARSNAVLTTESKVTIRGQTTIPAPVREALKLKPGLDSIHYEILPGGQVFMCRLGDEQEDHTMNAFLRFLDADIQNN
PQKTRPFDIQQGKKLVAGMDVNIDDEIGDDE
MPANARSNAVLTTESKVTIRGQTTIPAPVREALKLKPGLDSIHYEILPGGQVFMCRLGDEQEDHTMNAFLRFLDADIQNN
PQKTRPFDIQQGKKLVAGMDVNIDDEIGDDE
Download Length: 336 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PPV5 |