Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2077041..2077768 | Replicon | chromosome |
Accession | NZ_OY019088 | ||
Organism | Escherichia coli O25b:H4-ST131 isolate 42 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | QU406_RS10120 | Protein ID | WP_000550189.1 |
Coordinates | 2077454..2077768 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QU406_RS10115 | Protein ID | WP_000560269.1 |
Coordinates | 2077041..2077457 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QU406_RS10105 (2072401) | 2072401..2074752 | + | 2352 | WP_000695432.1 | alpha-glucosidase | - |
QU406_RS10110 (2074978) | 2074978..2076996 | + | 2019 | WP_000121413.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
QU406_RS10115 (2077041) | 2077041..2077457 | - | 417 | WP_000560269.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
QU406_RS10120 (2077454) | 2077454..2077768 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
QU406_RS10125 (2078053) | 2078053..2079189 | - | 1137 | WP_000018703.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
QU406_RS10130 (2079274) | 2079274..2079777 | + | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
QU406_RS10135 (2079854) | 2079854..2080546 | + | 693 | WP_000942551.1 | vancomycin high temperature exclusion protein | - |
QU406_RS10140 (2080625) | 2080625..2081611 | + | 987 | WP_001385498.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T297202 WP_000550189.1 NZ_OY019088:c2077768-2077454 [Escherichia coli O25b:H4-ST131]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15023.47 Da Isoelectric Point: 4.4547
>AT297202 WP_000560269.1 NZ_OY019088:c2077457-2077041 [Escherichia coli O25b:H4-ST131]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|