Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
| Location | 831728..832230 | Replicon | chromosome |
| Accession | NZ_OY019088 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 42 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | E2QNP2 |
| Locus tag | QU406_RS04355 | Protein ID | WP_000767819.1 |
| Coordinates | 831728..831982 (-) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | E2QNP3 |
| Locus tag | QU406_RS04360 | Protein ID | WP_001259253.1 |
| Coordinates | 831979..832230 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QU406_RS04330 (827546) | 827546..828004 | - | 459 | WP_001531805.1 | IS200/IS605-like element IS200C family transposase | - |
| QU406_RS04335 (828221) | 828221..829579 | - | 1359 | WP_000019194.1 | putrescine/proton symporter PlaP | - |
| QU406_RS04340 (829569) | 829569..829631 | - | 63 | WP_010723108.1 | membrane protein YoeI | - |
| QU406_RS04345 (829846) | 829846..830775 | - | 930 | WP_000803366.1 | LysR substrate-binding domain-containing protein | - |
| QU406_RS04350 (830821) | 830821..831645 | - | 825 | WP_000754737.1 | SDR family oxidoreductase | - |
| QU406_RS04355 (831728) | 831728..831982 | - | 255 | WP_000767819.1 | type II toxin-antitoxin system mRNA interferase toxin YoeB | Toxin |
| QU406_RS04360 (831979) | 831979..832230 | - | 252 | WP_001259253.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
| QU406_RS04365 (832513) | 832513..832563 | + | 51 | WP_001364200.1 | his operon leader peptide | - |
| QU406_RS04370 (832709) | 832709..833608 | + | 900 | WP_000131782.1 | ATP phosphoribosyltransferase | - |
| QU406_RS04375 (833614) | 833614..834918 | + | 1305 | WP_001296211.1 | histidinol dehydrogenase | - |
| QU406_RS04380 (834915) | 834915..835985 | + | 1071 | WP_000108967.1 | histidinol-phosphate transaminase | - |
| QU406_RS04385 (835985) | 835985..837052 | + | 1068 | WP_000080057.1 | bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 827546..828004 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10110.53 Da Isoelectric Point: 7.2749
>T297199 WP_000767819.1 NZ_OY019088:c831982-831728 [Escherichia coli O25b:H4-ST131]
VKLIWSEESWDDYLYWQEADKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHLLVYAVTDDSLLIAAC
RYHY
VKLIWSEESWDDYLYWQEADKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHLLVYAVTDDSLLIAAC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|