Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 110193..110788 | Replicon | chromosome |
Accession | NZ_OX638701 | ||
Organism | Pseudomonas aeruginosa strain 4782MK isolate 4782MK |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | QSK41_RS00535 | Protein ID | WP_003113526.1 |
Coordinates | 110510..110788 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QSK41_RS00530 | Protein ID | WP_003113527.1 |
Coordinates | 110193..110498 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSK41_RS00510 (PAER4782_00505) | 105525..106244 | + | 720 | WP_016264164.1 | hypothetical protein | - |
QSK41_RS00515 (PAER4782_00510) | 106305..108074 | - | 1770 | WP_033970867.1 | hypothetical protein | - |
QSK41_RS00520 | 108071..108547 | - | 477 | WP_049873961.1 | hypothetical protein | - |
QSK41_RS00525 (PAER4782_00515) | 108544..109713 | - | 1170 | WP_023129358.1 | dsDNA nuclease domain-containing protein | - |
QSK41_RS00530 (PAER4782_00520) | 110193..110498 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
QSK41_RS00535 | 110510..110788 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QSK41_RS00540 | 110841..110969 | - | 129 | Protein_105 | integrase | - |
QSK41_RS00545 (PAER4782_00525) | 111250..112005 | - | 756 | WP_003298407.1 | IS21-like element helper ATPase IstB | - |
QSK41_RS00550 (PAER4782_00530) | 112023..113537 | - | 1515 | WP_057391508.1 | IS21 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 94657..113537 | 18880 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T297184 WP_003113526.1 NZ_OX638701:c110788-110510 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|