Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 1746646..1747241 | Replicon | chromosome |
Accession | NZ_OX638610 | ||
Organism | Pseudomonas aeruginosa strain 3541 isolate 3541 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | QPK16_RS08050 | Protein ID | WP_003113526.1 |
Coordinates | 1746646..1746924 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QPK16_RS08055 | Protein ID | WP_043096613.1 |
Coordinates | 1746936..1747241 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPK16_RS08030 (JCHGIK_09385) | 1742071..1743309 | + | 1239 | WP_023084819.1 | C69 family dipeptidase | - |
QPK16_RS08035 (JCHGIK_09390) | 1743371..1744018 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
QPK16_RS08040 (JCHGIK_09395) | 1744089..1746317 | - | 2229 | WP_043096614.1 | TonB-dependent receptor | - |
QPK16_RS08045 | 1746465..1746593 | + | 129 | Protein_1587 | integrase | - |
QPK16_RS08050 | 1746646..1746924 | + | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QPK16_RS08055 (JCHGIK_09400) | 1746936..1747241 | + | 306 | WP_043096613.1 | HigA family addiction module antitoxin | Antitoxin |
QPK16_RS08065 (JCHGIK_09410) | 1747647..1748747 | - | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
QPK16_RS08070 (JCHGIK_09415) | 1748788..1749372 | - | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
QPK16_RS08075 (JCHGIK_09420) | 1749414..1750028 | - | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
QPK16_RS08080 (JCHGIK_09425) | 1750145..1751086 | - | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
QPK16_RS08090 (JCHGIK_09435) | 1751253..1752101 | - | 849 | WP_003117426.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T297177 WP_003113526.1 NZ_OX638610:1746646-1746924 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|