Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5963683..5964278 | Replicon | chromosome |
| Accession | NZ_OX638564 | ||
| Organism | Pseudomonas aeruginosa strain 3796A isolate 3796A | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | QRQ54_RS27825 | Protein ID | WP_003113526.1 |
| Coordinates | 5964000..5964278 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QRQ54_RS27820 | Protein ID | WP_043096613.1 |
| Coordinates | 5963683..5963988 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRQ54_RS27785 (PAE3796A_27625) | 5958823..5959671 | + | 849 | WP_003117426.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| QRQ54_RS27795 (PAE3796A_27635) | 5959838..5960779 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| QRQ54_RS27800 (PAE3796A_27640) | 5960896..5961510 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| QRQ54_RS27805 (PAE3796A_27645) | 5961552..5962136 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| QRQ54_RS27810 (PAE3796A_27650) | 5962177..5963277 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| QRQ54_RS27820 (PAE3796A_27660) | 5963683..5963988 | - | 306 | WP_043096613.1 | HigA family addiction module antitoxin | Antitoxin |
| QRQ54_RS27825 | 5964000..5964278 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QRQ54_RS27830 | 5964331..5964459 | - | 129 | Protein_5503 | integrase | - |
| QRQ54_RS27835 (PAE3796A_27665) | 5964607..5966835 | + | 2229 | WP_043096614.1 | TonB-dependent receptor | - |
| QRQ54_RS27840 (PAE3796A_27670) | 5966906..5967553 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| QRQ54_RS27845 (PAE3796A_27675) | 5967615..5968853 | - | 1239 | WP_023084819.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T297174 WP_003113526.1 NZ_OX638564:c5964278-5964000 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|