Detailed information of TA system TA297167

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 29876..30302
• Replicon: plasmid P2
• Accession: NZ_OX637966
• Organism: Escherichia coli O25b:H4-ST131 isolate 46

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QQG90_RS26600
• Protein ID: WP_001372321.1
• Coordinates: 30177..30302 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	29876..30100 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QQG90_RS26565 (25844)	25844..26341	+	498	WP_138168781.1	single-stranded DNA-binding protein	-
QQG90_RS26570 (26403)	26403..26636	+	234	WP_000006030.1	DUF905 family protein	-
QQG90_RS26575 (26701)	26701..28659	+	1959	WP_001526004.1	ParB/RepB/Spo0J family partition protein	-
QQG90_RS26580 (28714)	28714..29148	+	435	WP_000845910.1	conjugation system SOS inhibitor PsiB	-
QQG90_RS26585 (29145)	29145..29907	+	763	Protein_37	plasmid SOS inhibition protein A	-
QQG90_RS26590 (29876)	29876..30064	-	189	WP_001336239.1	hypothetical protein	-
- (30033)	30033..30098	+	66	NuclAT_1	-	-
- (29876)	29876..30100	+	225	NuclAT_0	-	Antitoxin
- (29876)	29876..30100	+	225	NuclAT_0	-	Antitoxin
- (29876)	29876..30100	+	225	NuclAT_0	-	Antitoxin
- (29876)	29876..30100	+	225	NuclAT_0	-	Antitoxin
- (29876)	29876..30100	-	225	NuclAT_0	-	-
QQG90_RS26595 (30086)	30086..30235	+	150	Protein_39	plasmid maintenance protein Mok	-
QQG90_RS26600 (30177)	30177..30302	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QQG90_RS26605 (30756)	30756..30929	-	174	Protein_41	hypothetical protein	-
QQG90_RS26610 (31229)	31229..31516	+	288	WP_000107526.1	hypothetical protein	-
QQG90_RS26615 (31635)	31635..32456	+	822	WP_001234469.1	DUF932 domain-containing protein	-
QQG90_RS26620 (32751)	32751..33353	-	603	WP_023908348.1	transglycosylase SLT domain-containing protein	-
QQG90_RS26625 (33676)	33676..34059	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QQG90_RS26630 (34253)	34253..34924	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
QQG90_RS26635 (35061)	35061..35288	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..74854	74854

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T297167 WP_001372321.1 NZ_OX637966:30177-30302 [Escherichia coli O25b:H4-ST131]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT297167 NZ_OX637966:29876-30100 [Escherichia coli O25b:H4-ST131]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGTCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin