Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 29876..30302 | Replicon | plasmid P2 |
| Accession | NZ_OX637966 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 46 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QQG90_RS26600 | Protein ID | WP_001372321.1 |
| Coordinates | 30177..30302 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 29876..30100 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQG90_RS26565 (25844) | 25844..26341 | + | 498 | WP_138168781.1 | single-stranded DNA-binding protein | - |
| QQG90_RS26570 (26403) | 26403..26636 | + | 234 | WP_000006030.1 | DUF905 family protein | - |
| QQG90_RS26575 (26701) | 26701..28659 | + | 1959 | WP_001526004.1 | ParB/RepB/Spo0J family partition protein | - |
| QQG90_RS26580 (28714) | 28714..29148 | + | 435 | WP_000845910.1 | conjugation system SOS inhibitor PsiB | - |
| QQG90_RS26585 (29145) | 29145..29907 | + | 763 | Protein_37 | plasmid SOS inhibition protein A | - |
| QQG90_RS26590 (29876) | 29876..30064 | - | 189 | WP_001336239.1 | hypothetical protein | - |
| - (30033) | 30033..30098 | + | 66 | NuclAT_1 | - | - |
| - (29876) | 29876..30100 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (29876) | 29876..30100 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (29876) | 29876..30100 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (29876) | 29876..30100 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (29876) | 29876..30100 | - | 225 | NuclAT_0 | - | - |
| QQG90_RS26595 (30086) | 30086..30235 | + | 150 | Protein_39 | plasmid maintenance protein Mok | - |
| QQG90_RS26600 (30177) | 30177..30302 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QQG90_RS26605 (30756) | 30756..30929 | - | 174 | Protein_41 | hypothetical protein | - |
| QQG90_RS26610 (31229) | 31229..31516 | + | 288 | WP_000107526.1 | hypothetical protein | - |
| QQG90_RS26615 (31635) | 31635..32456 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| QQG90_RS26620 (32751) | 32751..33353 | - | 603 | WP_023908348.1 | transglycosylase SLT domain-containing protein | - |
| QQG90_RS26625 (33676) | 33676..34059 | + | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QQG90_RS26630 (34253) | 34253..34924 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| QQG90_RS26635 (35061) | 35061..35288 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..74854 | 74854 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T297167 WP_001372321.1 NZ_OX637966:30177-30302 [Escherichia coli O25b:H4-ST131]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT297167 NZ_OX637966:29876-30100 [Escherichia coli O25b:H4-ST131]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGTCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGTCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|