Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 47851..48090 | Replicon | plasmid P1 |
| Accession | NZ_OX637965 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 46 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | QQG90_RS25970 | Protein ID | WP_023144756.1 |
| Coordinates | 47851..47985 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 48030..48090 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQG90_RS25945 (43553) | 43553..44410 | - | 858 | WP_000130640.1 | incFII family plasmid replication initiator RepA | - |
| QQG90_RS25950 (44403) | 44403..44477 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| QQG90_RS25955 (44714) | 44714..44929 | - | 216 | Protein_51 | replication regulatory protein RepA | - |
| QQG90_RS25960 (45120) | 45120..46661 | + | 1542 | WP_002431311.1 | IS21-like element ISEc12 family transposase | - |
| QQG90_RS25965 (46676) | 46676..47422 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QQG90_RS25970 (47851) | 47851..47985 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (48030) | 48030..48090 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (48030) | 48030..48090 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (48030) | 48030..48090 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (48030) | 48030..48090 | + | 61 | NuclAT_2 | - | Antitoxin |
| QQG90_RS25975 (48057) | 48057..48343 | - | 287 | Protein_55 | DUF2726 domain-containing protein | - |
| QQG90_RS25980 (48856) | 48856..49068 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| QQG90_RS25985 (49199) | 49199..49759 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| QQG90_RS25990 (49814) | 49814..50560 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 | senB | 1..123938 | 123938 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T297161 WP_023144756.1 NZ_OX637965:c47985-47851 [Escherichia coli O25b:H4-ST131]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT297161 NZ_OX637965:48030-48090 [Escherichia coli O25b:H4-ST131]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|