Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 47851..48090 Replicon plasmid P1
Accession NZ_OX637965
Organism Escherichia coli O25b:H4-ST131 isolate 46

Toxin (Protein)


Gene name srnB Uniprot ID A0A762TWR7
Locus tag QQG90_RS25970 Protein ID WP_023144756.1
Coordinates 47851..47985 (-) Length 45 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 48030..48090 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQG90_RS25945 (43553) 43553..44410 - 858 WP_000130640.1 incFII family plasmid replication initiator RepA -
QQG90_RS25950 (44403) 44403..44477 - 75 WP_031943482.1 RepA leader peptide Tap -
QQG90_RS25955 (44714) 44714..44929 - 216 Protein_51 replication regulatory protein RepA -
QQG90_RS25960 (45120) 45120..46661 + 1542 WP_002431311.1 IS21-like element ISEc12 family transposase -
QQG90_RS25965 (46676) 46676..47422 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QQG90_RS25970 (47851) 47851..47985 - 135 WP_023144756.1 Hok/Gef family protein Toxin
- (48030) 48030..48090 + 61 NuclAT_2 - Antitoxin
- (48030) 48030..48090 + 61 NuclAT_2 - Antitoxin
- (48030) 48030..48090 + 61 NuclAT_2 - Antitoxin
- (48030) 48030..48090 + 61 NuclAT_2 - Antitoxin
QQG90_RS25975 (48057) 48057..48343 - 287 Protein_55 DUF2726 domain-containing protein -
QQG90_RS25980 (48856) 48856..49068 - 213 WP_013023861.1 hypothetical protein -
QQG90_RS25985 (49199) 49199..49759 - 561 WP_000139341.1 fertility inhibition protein FinO -
QQG90_RS25990 (49814) 49814..50560 - 747 WP_000205718.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA17 / aadA5 / qacE / sul1 senB 1..123938 123938


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-44)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4896.90 Da        Isoelectric Point: 7.7209

>T297161 WP_023144756.1 NZ_OX637965:c47985-47851 [Escherichia coli O25b:H4-ST131]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Download         Length: 135 bp

Antitoxin


Download         Length: 61 bp

>AT297161 NZ_OX637965:48030-48090 [Escherichia coli O25b:H4-ST131]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A762TWR7

Antitoxin

Download structure file

References