Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4975523..4976125 | Replicon | chromosome |
Accession | NZ_OX637964 | ||
Organism | Escherichia coli O25b:H4-ST131 isolate 46 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | QQG90_RS24685 | Protein ID | WP_000897302.1 |
Coordinates | 4975814..4976125 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QQG90_RS24680 | Protein ID | WP_000356397.1 |
Coordinates | 4975523..4975813 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQG90_RS24650 (4970829) | 4970829..4971758 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
QQG90_RS24655 (4971940) | 4971940..4972182 | - | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
QQG90_RS24660 (4972472) | 4972472..4973320 | + | 849 | WP_001038650.1 | hypothetical protein | - |
QQG90_RS24665 (4973345) | 4973345..4974085 | + | 741 | WP_000608806.1 | hypothetical protein | - |
QQG90_RS24670 (4974270) | 4974270..4974488 | - | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
QQG90_RS24675 (4974886) | 4974886..4975164 | - | 279 | WP_001296612.1 | hypothetical protein | - |
QQG90_RS24680 (4975523) | 4975523..4975813 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QQG90_RS24685 (4975814) | 4975814..4976125 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
QQG90_RS24690 (4976354) | 4976354..4977262 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
QQG90_RS24695 (4977326) | 4977326..4978267 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QQG90_RS24700 (4978312) | 4978312..4978749 | - | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
QQG90_RS24705 (4978746) | 4978746..4979618 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QQG90_RS24710 (4979612) | 4979612..4980211 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T297160 WP_000897302.1 NZ_OX637964:c4976125-4975814 [Escherichia coli O25b:H4-ST131]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|