Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3667101..3667780 | Replicon | chromosome |
Accession | NZ_OX637964 | ||
Organism | Escherichia coli O25b:H4-ST131 isolate 46 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | QQG90_RS18390 | Protein ID | WP_000057523.1 |
Coordinates | 3667478..3667780 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | QQG90_RS18385 | Protein ID | WP_000806442.1 |
Coordinates | 3667101..3667442 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQG90_RS18375 (3663345) | 3663345..3664277 | - | 933 | WP_000883041.1 | glutaminase A | - |
QQG90_RS18380 (3664539) | 3664539..3667043 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
QQG90_RS18385 (3667101) | 3667101..3667442 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
QQG90_RS18390 (3667478) | 3667478..3667780 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QQG90_RS18395 (3667913) | 3667913..3668707 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
QQG90_RS18400 (3668911) | 3668911..3669390 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
QQG90_RS18405 (3669414) | 3669414..3670214 | + | 801 | WP_000439798.1 | hypothetical protein | - |
QQG90_RS18410 (3670211) | 3670211..3670714 | + | 504 | WP_000667000.1 | hypothetical protein | - |
QQG90_RS18415 (3670752) | 3670752..3672404 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T297151 WP_000057523.1 NZ_OX637964:c3667780-3667478 [Escherichia coli O25b:H4-ST131]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 13171.10 Da Isoelectric Point: 5.7790
>AT297151 WP_000806442.1 NZ_OX637964:c3667442-3667101 [Escherichia coli O25b:H4-ST131]
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|