Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 66698..66937 | Replicon | plasmid P1 |
| Accession | NZ_OX637962 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 86 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | QQG89_RS24250 | Protein ID | WP_023144756.1 |
| Coordinates | 66698..66832 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 66877..66937 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQG89_RS24215 (62045) | 62045..62460 | - | 416 | Protein_73 | IS1-like element IS1B family transposase | - |
| QQG89_RS24220 (62709) | 62709..63110 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QQG89_RS24225 (63043) | 63043..63300 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QQG89_RS24230 (63393) | 63393..64046 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QQG89_RS24235 (64986) | 64986..65843 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| QQG89_RS24240 (65836) | 65836..65910 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| QQG89_RS24245 (66147) | 66147..66401 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| QQG89_RS24250 (66698) | 66698..66832 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (66877) | 66877..66937 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (66877) | 66877..66937 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (66877) | 66877..66937 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (66877) | 66877..66937 | + | 61 | NuclAT_2 | - | Antitoxin |
| QQG89_RS24255 (66904) | 66904..67190 | - | 287 | Protein_81 | DUF2726 domain-containing protein | - |
| QQG89_RS24260 (67268) | 67268..68881 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| QQG89_RS24265 (68912) | 68912..69262 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QQG89_RS24270 (69259) | 69259..69684 | - | 426 | WP_000422741.1 | transposase | - |
| QQG89_RS24275 (70243) | 70243..70455 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| QQG89_RS24280 (70586) | 70586..71146 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..146919 | 146919 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T297130 WP_023144756.1 NZ_OX637962:c66832-66698 [Escherichia coli O25b:H4-ST131]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT297130 NZ_OX637962:66877-66937 [Escherichia coli O25b:H4-ST131]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
