Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
Location | 1902224..1902726 | Replicon | chromosome |
Accession | NZ_OX637961 | ||
Organism | Escherichia coli O25b:H4-ST131 isolate 86 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | S1P977 |
Locus tag | QQG89_RS09055 | Protein ID | WP_000767822.1 |
Coordinates | 1902472..1902726 (+) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | S1Q063 |
Locus tag | QQG89_RS09050 | Protein ID | WP_001259255.1 |
Coordinates | 1902224..1902475 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQG89_RS09025 (1897402) | 1897402..1898469 | - | 1068 | WP_000080105.1 | bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB | - |
QQG89_RS09030 (1898469) | 1898469..1899539 | - | 1071 | WP_000108941.1 | histidinol-phosphate transaminase | - |
QQG89_RS09035 (1899536) | 1899536..1900840 | - | 1305 | WP_001546022.1 | histidinol dehydrogenase | - |
QQG89_RS09040 (1900846) | 1900846..1901745 | - | 900 | WP_000131782.1 | ATP phosphoribosyltransferase | - |
QQG89_RS09045 (1901891) | 1901891..1901941 | - | 51 | WP_001364200.1 | his operon leader peptide | - |
QQG89_RS09050 (1902224) | 1902224..1902475 | + | 252 | WP_001259255.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
QQG89_RS09055 (1902472) | 1902472..1902726 | + | 255 | WP_000767822.1 | type II toxin-antitoxin system mRNA interferase toxin YoeB | Toxin |
QQG89_RS09060 (1902809) | 1902809..1903633 | + | 825 | WP_000754737.1 | SDR family oxidoreductase | - |
QQG89_RS09065 (1903679) | 1903679..1904608 | + | 930 | WP_000803366.1 | LysR substrate-binding domain-containing protein | - |
QQG89_RS09070 (1904823) | 1904823..1904885 | + | 63 | WP_010723108.1 | membrane protein YoeI | - |
QQG89_RS09075 (1904875) | 1904875..1906233 | + | 1359 | WP_000019194.1 | putrescine/proton symporter PlaP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10183.58 Da Isoelectric Point: 8.0353
>T297114 WP_000767822.1 NZ_OX637961:1902472-1902726 [Escherichia coli O25b:H4-ST131]
VKLIWSEESWDDYLYWQETDKRIVKKINEIIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAAC
RYHY
VKLIWSEESWDDYLYWQETDKRIVKKINEIIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAAC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1P977 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2A6Q | |
AlphaFold DB | A0A7U9LNR0 |