Detailed information of TA system TA297103

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 123899..124325
• Replicon: plasmid P1
• Accession: NZ_OX637960
• Organism: Escherichia coli O25b:H4-ST131 isolate 32

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QQG88_RS24590
• Protein ID: WP_001372321.1
• Coordinates: 123899..124024 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	124101..124325 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QQG88_RS24560 (119216)	119216..120037	-	822	WP_001234445.1	DUF932 domain-containing protein	-
QQG88_RS24565 (120148)	120148..120444	-	297	WP_001272251.1	hypothetical protein	-
QQG88_RS24570 (120744)	120744..121040	+	297	Protein_138	hypothetical protein	-
QQG88_RS24575 (121125)	121125..122738	-	1614	WP_000080200.1	IS66-like element ISEc23 family transposase	-
QQG88_RS24580 (122769)	122769..123119	-	351	WP_000624722.1	IS66 family insertion sequence element accessory protein TnpB	-
QQG88_RS24585 (123116)	123116..123541	-	426	WP_000422741.1	transposase	-
QQG88_RS24590 (123899)	123899..124024	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QQG88_RS24595 (123966)	123966..124115	-	150	Protein_143	plasmid maintenance protein Mok	-
QQG88_RS24600 (124137)	124137..124316	+	180	WP_001309233.1	hypothetical protein	-
- (124101)	124101..124325	-	225	NuclAT_0	-	Antitoxin
- (124101)	124101..124325	-	225	NuclAT_0	-	Antitoxin
- (124101)	124101..124325	-	225	NuclAT_0	-	Antitoxin
- (124101)	124101..124325	-	225	NuclAT_0	-	Antitoxin
QQG88_RS24605 (124294)	124294..125056	-	763	Protein_145	plasmid SOS inhibition protein A	-
QQG88_RS24610 (125053)	125053..125487	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QQG88_RS24615 (125556)	125556..127579	-	2024	Protein_147	ParB/RepB/Spo0J family partition protein	-
QQG88_RS24620 (127640)	127640..127873	-	234	WP_000006003.1	DUF905 family protein	-
QQG88_RS24625 (127931)	127931..128458	-	528	WP_000290834.1	single-stranded DNA-binding protein	-
QQG88_RS24630 (128760)	128760..129227	+	468	Protein_150	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aadA5 / qacE / sul1 / mph(A) / blaCTX-M-27 / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr	senB	1..162859	162859

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T297103 WP_001372321.1 NZ_OX637960:c124024-123899 [Escherichia coli O25b:H4-ST131]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT297103 NZ_OX637960:c124325-124101 [Escherichia coli O25b:H4-ST131]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin