Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3571438..3572117 | Replicon | chromosome |
Accession | NZ_OX637959 | ||
Organism | Escherichia coli O25b:H4-ST131 isolate 32 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | QQG88_RS17505 | Protein ID | WP_000057523.1 |
Coordinates | 3571815..3572117 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | QQG88_RS17500 | Protein ID | WP_000806442.1 |
Coordinates | 3571438..3571779 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQG88_RS17490 (3567682) | 3567682..3568614 | - | 933 | WP_000883041.1 | glutaminase A | - |
QQG88_RS17495 (3568876) | 3568876..3571380 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
QQG88_RS17500 (3571438) | 3571438..3571779 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
QQG88_RS17505 (3571815) | 3571815..3572117 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QQG88_RS17510 (3572250) | 3572250..3573044 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
QQG88_RS17515 (3573248) | 3573248..3573727 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
QQG88_RS17520 (3573751) | 3573751..3574551 | + | 801 | WP_000439798.1 | hypothetical protein | - |
QQG88_RS17525 (3574548) | 3574548..3575051 | + | 504 | WP_000667000.1 | hypothetical protein | - |
QQG88_RS17530 (3575089) | 3575089..3576741 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T297096 WP_000057523.1 NZ_OX637959:c3572117-3571815 [Escherichia coli O25b:H4-ST131]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 13171.10 Da Isoelectric Point: 5.7790
>AT297096 WP_000806442.1 NZ_OX637959:c3571779-3571438 [Escherichia coli O25b:H4-ST131]
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|