Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 643351..644078 | Replicon | chromosome |
Accession | NZ_OX637959 | ||
Organism | Escherichia coli O25b:H4-ST131 isolate 32 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | QQG88_RS03190 | Protein ID | WP_000550189.1 |
Coordinates | 643351..643665 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QQG88_RS03195 | Protein ID | WP_000560269.1 |
Coordinates | 643662..644078 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQG88_RS03170 (639508) | 639508..640494 | - | 987 | WP_001385498.1 | Gfo/Idh/MocA family oxidoreductase | - |
QQG88_RS03175 (640573) | 640573..641265 | - | 693 | WP_000942551.1 | vancomycin high temperature exclusion protein | - |
QQG88_RS03180 (641342) | 641342..641845 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
QQG88_RS03185 (641930) | 641930..643066 | + | 1137 | WP_000018703.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
QQG88_RS03190 (643351) | 643351..643665 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
QQG88_RS03195 (643662) | 643662..644078 | + | 417 | WP_000560269.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
QQG88_RS03200 (644123) | 644123..646141 | - | 2019 | WP_000121413.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
QQG88_RS03205 (646367) | 646367..648718 | - | 2352 | WP_000695431.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T297084 WP_000550189.1 NZ_OX637959:643351-643665 [Escherichia coli O25b:H4-ST131]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15023.47 Da Isoelectric Point: 4.4547
>AT297084 WP_000560269.1 NZ_OX637959:643662-644078 [Escherichia coli O25b:H4-ST131]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|