Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 12476..13134 Replicon plasmid SF1039_p1
Accession NZ_OX461118
Organism Shewanella baltica strain SF1039 isolate SF1039

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag QOT06_RS21765 Protein ID WP_283631239.1
Coordinates 12784..13134 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QOT06_RS21760 Protein ID WP_283631237.1
Coordinates 12476..12778 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QOT06_RS21725 8265..9125 + 861 WP_283631226.1 DsbA family protein -
QOT06_RS21730 9344..9847 + 504 WP_283631228.1 hypothetical protein -
QOT06_RS21735 9857..10294 + 438 WP_283631229.1 Fe3+-siderophore ABC transporter permease -
QOT06_RS21740 10321..11178 + 858 WP_283631231.1 hypothetical protein -
QOT06_RS21745 11209..11736 + 528 WP_283631233.1 thermonuclease family protein -
QOT06_RS21750 11794..12066 + 273 WP_283631234.1 HU family DNA-binding protein -
QOT06_RS21755 12154..12447 + 294 WP_283631236.1 chromosome segregation protein ParM -
QOT06_RS21760 12476..12778 - 303 WP_283631237.1 XRE family transcriptional regulator Antitoxin
QOT06_RS21765 12784..13134 - 351 WP_283631239.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QOT06_RS21770 13573..13767 + 195 WP_013141683.1 hypothetical protein -
QOT06_RS21775 13778..13864 + 87 Protein_20 hypothetical protein -
QOT06_RS21780 14443..14709 + 267 WP_107884988.1 hypothetical protein -
QOT06_RS21785 15018..15539 - 522 WP_107239196.1 MarR family winged helix-turn-helix transcriptional regulator -
QOT06_RS21790 15694..16593 + 900 WP_107238734.1 haloalkane dehalogenase -
QOT06_RS21795 16680..17372 + 693 WP_107884989.1 IS6 family transposase -
QOT06_RS21800 17465..17998 + 534 WP_107884991.1 beta/gamma crystallin-related protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..141179 141179


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13284.09 Da        Isoelectric Point: 4.9362

>T297074 WP_283631239.1 NZ_OX461118:c13134-12784 [Shewanella baltica]
MWAIETTDTFDEWFDTLDDTDRANVLASMIVLQDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPLRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11084.88 Da        Isoelectric Point: 8.4846

>AT297074 WP_283631237.1 NZ_OX461118:c12778-12476 [Shewanella baltica]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMKLTQGEIAAYLGVKQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFSV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References