Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 12476..13134 | Replicon | plasmid SF1039_p1 |
| Accession | NZ_OX461118 | ||
| Organism | Shewanella baltica strain SF1039 isolate SF1039 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QOT06_RS21765 | Protein ID | WP_283631239.1 |
| Coordinates | 12784..13134 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QOT06_RS21760 | Protein ID | WP_283631237.1 |
| Coordinates | 12476..12778 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOT06_RS21725 | 8265..9125 | + | 861 | WP_283631226.1 | DsbA family protein | - |
| QOT06_RS21730 | 9344..9847 | + | 504 | WP_283631228.1 | hypothetical protein | - |
| QOT06_RS21735 | 9857..10294 | + | 438 | WP_283631229.1 | Fe3+-siderophore ABC transporter permease | - |
| QOT06_RS21740 | 10321..11178 | + | 858 | WP_283631231.1 | hypothetical protein | - |
| QOT06_RS21745 | 11209..11736 | + | 528 | WP_283631233.1 | thermonuclease family protein | - |
| QOT06_RS21750 | 11794..12066 | + | 273 | WP_283631234.1 | HU family DNA-binding protein | - |
| QOT06_RS21755 | 12154..12447 | + | 294 | WP_283631236.1 | chromosome segregation protein ParM | - |
| QOT06_RS21760 | 12476..12778 | - | 303 | WP_283631237.1 | XRE family transcriptional regulator | Antitoxin |
| QOT06_RS21765 | 12784..13134 | - | 351 | WP_283631239.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QOT06_RS21770 | 13573..13767 | + | 195 | WP_013141683.1 | hypothetical protein | - |
| QOT06_RS21775 | 13778..13864 | + | 87 | Protein_20 | hypothetical protein | - |
| QOT06_RS21780 | 14443..14709 | + | 267 | WP_107884988.1 | hypothetical protein | - |
| QOT06_RS21785 | 15018..15539 | - | 522 | WP_107239196.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| QOT06_RS21790 | 15694..16593 | + | 900 | WP_107238734.1 | haloalkane dehalogenase | - |
| QOT06_RS21795 | 16680..17372 | + | 693 | WP_107884989.1 | IS6 family transposase | - |
| QOT06_RS21800 | 17465..17998 | + | 534 | WP_107884991.1 | beta/gamma crystallin-related protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..141179 | 141179 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13284.09 Da Isoelectric Point: 4.9362
>T297074 WP_283631239.1 NZ_OX461118:c13134-12784 [Shewanella baltica]
MWAIETTDTFDEWFDTLDDTDRANVLASMIVLQDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPLRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWAIETTDTFDEWFDTLDDTDRANVLASMIVLQDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPLRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|