Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 38531..39282 | Replicon | plasmid EBP3064_p1 |
Accession | NZ_OX461106 | ||
Organism | Serratia proteamaculans strain EBP3064 isolate EBP3064 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A380D7R5 |
Locus tag | QOT07_RS25395 | Protein ID | WP_017891116.1 |
Coordinates | 38531..38842 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QOT07_RS25400 | Protein ID | WP_127147056.1 |
Coordinates | 38839..39282 (+) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT07_RS25375 | 33961..34467 | + | 507 | WP_130016783.1 | antirestriction protein | - |
QOT07_RS25380 | 35150..37186 | + | 2037 | WP_130016782.1 | ParB/RepB/Spo0J family partition protein | - |
QOT07_RS25385 | 37227..37691 | + | 465 | WP_130016781.1 | conjugation system SOS inhibitor PsiB | - |
QOT07_RS25390 | 37688..38416 | + | 729 | WP_130016780.1 | plasmid SOS inhibition protein A | - |
QOT07_RS25395 | 38531..38842 | + | 312 | WP_017891116.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
QOT07_RS25400 | 38839..39282 | + | 444 | WP_127147056.1 | helix-turn-helix domain-containing protein | Antitoxin |
QOT07_RS25405 | 39846..40298 | + | 453 | WP_129935340.1 | hypothetical protein | - |
QOT07_RS25410 | 40359..40508 | + | 150 | WP_165366321.1 | hypothetical protein | - |
QOT07_RS25415 | 40955..41773 | + | 819 | WP_130016779.1 | DUF932 domain-containing protein | - |
QOT07_RS25420 | 42262..42603 | - | 342 | WP_242503224.1 | mobilization protein MobC | - |
QOT07_RS25425 | 42872..43177 | + | 306 | WP_130016778.1 | plasmid mobilization protein MobA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..108855 | 108855 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12245.20 Da Isoelectric Point: 10.1438
>T297069 WP_017891116.1 NZ_OX461106:38531-38842 [Serratia proteamaculans]
VHVISRQPFNEAAGKYPNSALALLDLMRVLEKKTFNSPDEMKRAIPSLDNFKYRKKWWVIDVSGNTLRLMAFIDFEKQKV
FVKHIATHAEYDKLTKYYREHKE
VHVISRQPFNEAAGKYPNSALALLDLMRVLEKKTFNSPDEMKRAIPSLDNFKYRKKWWVIDVSGNTLRLMAFIDFEKQKV
FVKHIATHAEYDKLTKYYREHKE
Download Length: 312 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16064.33 Da Isoelectric Point: 4.5904
>AT297069 WP_127147056.1 NZ_OX461106:38839-39282 [Serratia proteamaculans]
MTVATHIDAASAEGMIATFANAVKCIPLMTGDKSEAEYKKALELIEYLVDRDELSNPLFEPLAAKITEYENSAPEFEAFN
RRLAEIPTGVAALRTLMDQHGLKAADLEDELGSKSNVSNILSGRRALTVQHIKALATRFDVPADLFI
MTVATHIDAASAEGMIATFANAVKCIPLMTGDKSEAEYKKALELIEYLVDRDELSNPLFEPLAAKITEYENSAPEFEAFN
RRLAEIPTGVAALRTLMDQHGLKAADLEDELGSKSNVSNILSGRRALTVQHIKALATRFDVPADLFI
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|