Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 4697154..4697850 | Replicon | chromosome |
Accession | NZ_OX460963 | ||
Organism | Hafnia paralvei strain MIP2461 isolate MIP2461 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | G9YDK7 |
Locus tag | QOT00_RS21660 | Protein ID | WP_004096963.1 |
Coordinates | 4697539..4697850 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | - |
Locus tag | QOT00_RS21655 | Protein ID | WP_223283572.1 |
Coordinates | 4697154..4697555 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT00_RS21640 | 4693896..4694738 | + | 843 | WP_130996012.1 | helix-turn-helix domain-containing protein | - |
QOT00_RS21645 | 4695055..4695342 | + | 288 | WP_008815650.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
QOT00_RS21650 | 4695424..4696911 | - | 1488 | WP_004096959.1 | glycerol-3-phosphate dehydrogenase | - |
QOT00_RS21655 | 4697154..4697555 | - | 402 | WP_223283572.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
QOT00_RS21660 | 4697539..4697850 | - | 312 | WP_004096963.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
QOT00_RS21665 | 4698100..4698858 | - | 759 | WP_004096965.1 | DeoR/GlpR family transcriptional regulator | - |
QOT00_RS21670 | 4698892..4699728 | - | 837 | WP_039186087.1 | rhomboid family intramembrane serine protease GlpG | - |
QOT00_RS21675 | 4699881..4700210 | - | 330 | WP_008815654.1 | thiosulfate sulfurtransferase GlpE | - |
QOT00_RS21680 | 4700484..4700918 | + | 435 | WP_283648223.1 | hypothetical protein | - |
QOT00_RS21685 | 4701594..4702337 | - | 744 | WP_008815656.1 | glycerophosphodiester phosphodiesterase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12128.96 Da Isoelectric Point: 9.0652
>T297037 WP_004096963.1 NZ_OX460963:c4697850-4697539 [Hafnia paralvei]
MEKRTPHCRLEKIRSLIGKGLIRATALSSRNARQLNFSRADMYRIVSELSTQDFHKSMTTYENHRVWQDVYHCHLDKVSL
YVKLTVIDEVLIVSFKELNDDMS
MEKRTPHCRLEKIRSLIGKGLIRATALSSRNARQLNFSRADMYRIVSELSTQDFHKSMTTYENHRVWQDVYHCHLDKVSL
YVKLTVIDEVLIVSFKELNDDMS
Download Length: 312 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14799.14 Da Isoelectric Point: 4.9471
>AT297037 WP_223283572.1 NZ_OX460963:c4697555-4697154 [Hafnia paralvei]
MMICPECGSVNTVKEYRDMPYTYKGQTIIVKAVGADWCLNCGEGVVFTEESIRIDSIMGDFNKQVNASIIEPEFVIAMRK
KLNLSQSEAGEIFGGGVNAFSRYETGKALPHVSTIKLLKLLDKYPELLAEIRD
MMICPECGSVNTVKEYRDMPYTYKGQTIIVKAVGADWCLNCGEGVVFTEESIRIDSIMGDFNKQVNASIIEPEFVIAMRK
KLNLSQSEAGEIFGGGVNAFSRYETGKALPHVSTIKLLKLLDKYPELLAEIRD
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|