Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 502222..502874 | Replicon | chromosome |
Accession | NZ_OX460909 | ||
Organism | Photobacterium phosphoreum strain MIP2473 isolate MIP2473 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2T3M7R5 |
Locus tag | QOS47_RS02550 | Protein ID | WP_045032861.1 |
Coordinates | 502527..502874 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QOS47_RS02545 | Protein ID | WP_045032858.1 |
Coordinates | 502222..502524 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOS47_RS02505 | 497832..498176 | + | 345 | WP_045032219.1 | hypothetical protein | - |
QOS47_RS02510 | 498287..498520 | - | 234 | WP_045032221.1 | hypothetical protein | - |
QOS47_RS02515 | 499058..499300 | + | 243 | WP_045032924.1 | hypothetical protein | - |
QOS47_RS02520 | 499555..500706 | + | 1152 | WP_107188197.1 | iron-containing alcohol dehydrogenase | - |
QOS47_RS02530 | 501400..501675 | - | 276 | WP_232605835.1 | helix-turn-helix transcriptional regulator | - |
QOS47_RS02535 | 501672..501794 | - | 123 | WP_232613877.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QOS47_RS02540 | 501799..501978 | - | 180 | WP_268875251.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QOS47_RS02545 | 502222..502524 | - | 303 | WP_045032858.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QOS47_RS02550 | 502527..502874 | - | 348 | WP_045032861.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QOS47_RS02555 | 503327..503605 | - | 279 | WP_283597067.1 | hypothetical protein | - |
QOS47_RS02560 | 503841..504365 | - | 525 | WP_283597070.1 | heavy metal-binding domain-containing protein | - |
QOS47_RS02565 | 505038..505280 | + | 243 | WP_045032924.1 | hypothetical protein | - |
QOS47_RS02570 | 505535..506686 | + | 1152 | WP_283597072.1 | iron-containing alcohol dehydrogenase | - |
QOS47_RS02575 | 506778..506990 | - | 213 | WP_045029221.1 | cold-shock protein | - |
QOS47_RS02580 | 507294..507746 | - | 453 | Protein_471 | DUF2333 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13108.92 Da Isoelectric Point: 5.1769
>T296992 WP_045032861.1 NZ_OX460909:c502874-502527 [Photobacterium phosphoreum]
MWTVITTDFFDEWFDAQSDDTQEKVLAGLVALQTGGPTIGRPLVDTVNASKYNNMKELRVQHRGDPIRAFFAFDPLRQAI
VLCAGNKGGNEKRFYKQMIPIADFEFAKHLEELEK
MWTVITTDFFDEWFDAQSDDTQEKVLAGLVALQTGGPTIGRPLVDTVNASKYNNMKELRVQHRGDPIRAFFAFDPLRQAI
VLCAGNKGGNEKRFYKQMIPIADFEFAKHLEELEK
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|