Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 2983810..2984412 | Replicon | chromosome |
Accession | NZ_OX442412 | ||
Organism | Salmonella enterica subsp. enterica serovar Rissen isolate pure strain |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A603E470 |
Locus tag | QM550_RS14820 | Protein ID | WP_023138876.1 |
Coordinates | 2983810..2984121 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QM550_RS14825 | Protein ID | WP_000362050.1 |
Coordinates | 2984122..2984412 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM550_RS14795 (2979767) | 2979767..2980366 | + | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
QM550_RS14800 (2980360) | 2980360..2981232 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
QM550_RS14805 (2981229) | 2981229..2981666 | + | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
QM550_RS14810 (2981711) | 2981711..2982652 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
QM550_RS14815 (2982678) | 2982678..2983592 | - | 915 | WP_023138875.1 | alpha/beta hydrolase | - |
QM550_RS14820 (2983810) | 2983810..2984121 | + | 312 | WP_023138876.1 | hypothetical protein | Toxin |
QM550_RS14825 (2984122) | 2984122..2984412 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
QM550_RS14830 (2984459) | 2984459..2985388 | - | 930 | WP_023138877.1 | formate dehydrogenase accessory protein FdhE | - |
QM550_RS14835 (2985385) | 2985385..2986020 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
QM550_RS14840 (2986017) | 2986017..2986919 | - | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12356.30 Da Isoelectric Point: 9.4460
>T296966 WP_023138876.1 NZ_OX442412:2983810-2984121 [Salmonella enterica subsp. enterica serovar Rissen]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT296966 WP_000362050.1 NZ_OX442412:2984122-2984412 [Salmonella enterica subsp. enterica serovar Rissen]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|