Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 1008347..1009074 Replicon chromosome
Accession NZ_OX442412
Organism Salmonella enterica subsp. enterica serovar Rissen isolate pure strain

Toxin (Protein)


Gene name higB Uniprot ID A0A8E5IJ81
Locus tag QM550_RS05095 Protein ID WP_000558157.1
Coordinates 1008347..1008658 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QM550_RS05100 Protein ID WP_000561389.1
Coordinates 1008655..1009074 (+) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM550_RS05055 (1003391) 1003391..1003786 + 396 WP_000422887.1 DUF1398 domain-containing protein -
QM550_RS05060 (1004115) 1004115..1004591 + 477 WP_023138823.1 hypothetical protein -
QM550_RS05065 (1004746) 1004746..1004895 + 150 WP_023138824.1 hypothetical protein -
QM550_RS05070 (1005007) 1005007..1005465 - 459 WP_001195655.1 hypothetical protein -
QM550_RS05075 (1005791) 1005791..1006938 + 1148 WP_112324583.1 IS3 family transposase -
QM550_RS05080 (1006969) 1006969..1007526 - 558 WP_000179886.1 hypothetical protein -
QM550_RS05085 (1007630) 1007630..1007839 - 210 WP_023137948.1 hypothetical protein -
QM550_RS05090 (1007869) 1007869..1008168 - 300 WP_000775225.1 hypothetical protein -
QM550_RS05095 (1008347) 1008347..1008658 + 312 WP_000558157.1 type II toxin-antitoxin system HigB family toxin Toxin
QM550_RS05100 (1008655) 1008655..1009074 + 420 WP_000561389.1 helix-turn-helix domain-containing protein Antitoxin
QM550_RS05105 (1009327) 1009327..1009979 + 653 Protein_1003 glycosyltransferase -
QM550_RS05110 (1010215) 1010215..1010634 - 420 WP_023137951.1 GNAT family N-acetyltransferase -
QM550_RS05115 (1011004) 1011004..1011273 + 270 WP_077908593.1 hypothetical protein -
QM550_RS05120 (1011439) 1011439..1011579 + 141 WP_001576018.1 hypothetical protein -
QM550_RS05125 (1011725) 1011725..1012266 - 542 Protein_1007 transposase -
QM550_RS05130 (1012286) 1012286..1012378 - 93 WP_231923105.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - sopE2 1001985..1012401 10416
- inside IScluster/Tn - - 1005791..1012063 6272


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(22-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(85-138)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12425.26 Da        Isoelectric Point: 10.1376

>T296958 WP_000558157.1 NZ_OX442412:1008347-1008658 [Salmonella enterica subsp. enterica serovar Rissen]
MHVISKEPFDEAARRYPNDSLAIKALYRLVREKDFSSPAELRKVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15301.49 Da        Isoelectric Point: 4.6286

>AT296958 WP_000561389.1 NZ_OX442412:1008655-1009074 [Salmonella enterica subsp. enterica serovar Rissen]
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References