Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | yonT-as-bsrE/- |
| Location | 1915777..1915994 | Replicon | chromosome |
| Accession | NZ_OX419652 | ||
| Organism | Bacillus subtilis isolate NRS6131 | ||
Toxin (Protein)
| Gene name | yonT | Uniprot ID | - |
| Locus tag | KJP56_RS09980 | Protein ID | WP_017696861.1 |
| Coordinates | 1915818..1915994 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrE | ||
| Locus tag | - | ||
| Coordinates | 1915777..1915877 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP56_RS09960 (1910787) | 1910787..1910958 | - | 172 | Protein_1906 | hypothetical protein | - |
| KJP56_RS09965 (1911515) | 1911515..1911793 | - | 279 | WP_213419758.1 | HU family DNA-binding protein | - |
| KJP56_RS09970 (1912047) | 1912047..1914572 | - | 2526 | WP_213419757.1 | hypothetical protein | - |
| KJP56_RS09975 (1914612) | 1914612..1914806 | - | 195 | WP_120363385.1 | hypothetical protein | - |
| - (1915777) | 1915777..1915877 | - | 101 | NuclAT_0 | - | Antitoxin |
| - (1915777) | 1915777..1915877 | - | 101 | NuclAT_0 | - | Antitoxin |
| - (1915777) | 1915777..1915877 | - | 101 | NuclAT_0 | - | Antitoxin |
| - (1915777) | 1915777..1915877 | - | 101 | NuclAT_0 | - | Antitoxin |
| KJP56_RS09980 (1915818) | 1915818..1915994 | + | 177 | WP_017696861.1 | hypothetical protein | Toxin |
| KJP56_RS09985 (1916013) | 1916013..1916263 | + | 251 | Protein_1911 | hypothetical protein | - |
| KJP56_RS09990 (1916308) | 1916308..1916496 | + | 189 | WP_213419756.1 | hypothetical protein | - |
| KJP56_RS09995 (1916582) | 1916582..1917799 | + | 1218 | WP_213419755.1 | hypothetical protein | - |
| KJP56_RS10000 (1918140) | 1918140..1918337 | + | 198 | WP_213419754.1 | hypothetical protein | - |
| KJP56_RS10005 (1918371) | 1918371..1918517 | + | 147 | WP_213419753.1 | hypothetical protein | - |
| KJP56_RS10010 (1918510) | 1918510..1918719 | + | 210 | WP_213419752.1 | hypothetical protein | - |
| KJP56_RS10015 (1918722) | 1918722..1918949 | + | 228 | WP_213419751.1 | hypothetical protein | - |
| KJP56_RS10020 (1919298) | 1919298..1919609 | + | 312 | WP_213419750.1 | hypothetical protein | - |
| KJP56_RS10025 (1919611) | 1919611..1919871 | + | 261 | WP_213419749.1 | hypothetical protein | - |
| KJP56_RS10030 (1920078) | 1920078..1920323 | + | 246 | WP_114168606.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1844962..1999121 | 154159 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6878.45 Da Isoelectric Point: 12.8833
>T296951 WP_017696861.1 NZ_OX419652:1915818-1915994 [Bacillus subtilis]
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT296951 NZ_OX419652:c1915877-1915777 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
