Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | bsrG-SR6/- |
| Location | 2269537..2269826 | Replicon | chromosome |
| Accession | NZ_OX419579 | ||
| Organism | Bacillus subtilis isolate NRS6103 | ||
Toxin (Protein)
| Gene name | bsrG | Uniprot ID | L8EAY0 |
| Locus tag | KJP43_RS11685 | Protein ID | WP_009967548.1 |
| Coordinates | 2269537..2269653 (+) | Length | 39 a.a. |
Antitoxin (RNA)
| Gene name | SR6 | ||
| Locus tag | - | ||
| Coordinates | 2269648..2269826 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP43_RS11655 (2264997) | 2264997..2266235 | - | 1239 | WP_142743355.1 | MFS transporter | - |
| KJP43_RS11660 (2266348) | 2266348..2267598 | - | 1251 | WP_153912306.1 | UV damage repair protein UvrX | - |
| KJP43_RS11665 (2267591) | 2267591..2267923 | - | 333 | WP_128473977.1 | YolD-like family protein | - |
| KJP43_RS11670 (2268097) | 2268097..2268432 | + | 336 | WP_004399073.1 | hypothetical protein | - |
| KJP43_RS11675 (2268475) | 2268475..2268831 | - | 357 | WP_019712874.1 | hypothetical protein | - |
| KJP43_RS11680 (2268837) | 2268837..2269304 | - | 468 | WP_128992107.1 | DUF4879 domain-containing protein | - |
| KJP43_RS11685 (2269537) | 2269537..2269653 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
| - (2269648) | 2269648..2269826 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2269648) | 2269648..2269826 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2269648) | 2269648..2269826 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2269648) | 2269648..2269826 | - | 179 | NuclAT_1 | - | Antitoxin |
| KJP43_RS11690 (2270277) | 2270277..2270840 | - | 564 | WP_250533594.1 | SMI1/KNR4 family protein | - |
| KJP43_RS11695 (2270854) | 2270854..2271342 | - | 489 | WP_041056186.1 | antitoxin YezG family protein | - |
| KJP43_RS11700 (2271349) | 2271349..2273259 | - | 1911 | WP_153912308.1 | ribonuclease YeeF family protein | - |
| KJP43_RS11705 (2273359) | 2273359..2273916 | - | 558 | WP_153912309.1 | SMI1/KNR4 family protein | - |
| KJP43_RS11710 (2273982) | 2273982..2274235 | - | 254 | Protein_2255 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2142959..2279223 | 136264 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T296924 WP_009967548.1 NZ_OX419579:2269537-2269653 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
Antitoxin
Download Length: 179 bp
>AT296924 NZ_OX419579:c2269826-2269648 [Bacillus subtilis]
AATGATACAAATAATTATTTTTTGCATTTTGATTTGTAGAAATGCATAAAATAAAAAGACCAGGGTGCTACCAACACCCC
AGCTCTGTACAAAAAGCTGCCCATCAAAGGGCTTGCTCAGATGTATGTGACATAGTAGACCAACCCTTTAGGGTCGCAAT
CTCAAGGGGAGGTCTATTT
AATGATACAAATAATTATTTTTTGCATTTTGATTTGTAGAAATGCATAAAATAAAAAGACCAGGGTGCTACCAACACCCC
AGCTCTGTACAAAAAGCTGCCCATCAAAGGGCTTGCTCAGATGTATGTGACATAGTAGACCAACCCTTTAGGGTCGCAAT
CTCAAGGGGAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|