Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2217779..2217996 | Replicon | chromosome |
Accession | NZ_OX419579 | ||
Organism | Bacillus subtilis isolate NRS6103 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | - |
Locus tag | KJP43_RS11425 | Protein ID | WP_017696861.1 |
Coordinates | 2217820..2217996 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2217779..2217879 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP43_RS11405 | 2213843..2215714 | - | 1872 | WP_194943300.1 | hypothetical protein | - |
KJP43_RS11410 | 2216042..2217259 | - | 1218 | WP_153912270.1 | hypothetical protein | - |
KJP43_RS11415 | 2217347..2217505 | - | 159 | Protein_2196 | hypothetical protein | - |
KJP43_RS11420 | 2217550..2217801 | - | 252 | WP_134853524.1 | hypothetical protein | - |
- | 2217779..2217879 | + | 101 | - | - | Antitoxin |
KJP43_RS11425 | 2217820..2217996 | - | 177 | WP_017696861.1 | hypothetical protein | Toxin |
- | 2217937..2218037 | + | 101 | NuclAT_0 | - | - |
- | 2217937..2218037 | + | 101 | NuclAT_0 | - | - |
- | 2217937..2218037 | + | 101 | NuclAT_0 | - | - |
- | 2217937..2218037 | + | 101 | NuclAT_0 | - | - |
KJP43_RS11430 | 2218894..2219394 | - | 501 | WP_153912271.1 | hypothetical protein | - |
KJP43_RS11435 | 2219770..2219949 | + | 180 | WP_153912273.1 | hypothetical protein | - |
KJP43_RS11440 | 2219994..2222519 | + | 2526 | WP_153912275.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2142959..2279223 | 136264 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6878.45 Da Isoelectric Point: 12.8833
>T296918 WP_017696861.1 NZ_OX419579:c2217996-2217820 [Bacillus subtilis]
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT296918 NZ_OX419579:2217779-2217879 [Bacillus subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|