Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 1866996..1867213 | Replicon | chromosome |
Accession | NZ_OX419577 | ||
Organism | Bacillus subtilis isolate NRS6120 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | - |
Locus tag | KJP47_RS09675 | Protein ID | WP_213383384.1 |
Coordinates | 1867037..1867213 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 1866996..1867096 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP47_RS09655 (1861999) | 1861999..1862110 | - | 112 | Protein_1846 | hypothetical protein | - |
KJP47_RS09660 (1862840) | 1862840..1863115 | - | 276 | WP_213383386.1 | HU family DNA-binding protein | - |
KJP47_RS09665 (1863369) | 1863369..1865888 | - | 2520 | WP_213383385.1 | DNA-directed RNA polymerase YonO | - |
KJP47_RS09670 (1865928) | 1865928..1866122 | - | 195 | WP_032721649.1 | hypothetical protein | - |
- (1866996) | 1866996..1867096 | - | 101 | NuclAT_0 | - | Antitoxin |
- (1866996) | 1866996..1867096 | - | 101 | NuclAT_0 | - | Antitoxin |
- (1866996) | 1866996..1867096 | - | 101 | NuclAT_0 | - | Antitoxin |
- (1866996) | 1866996..1867096 | - | 101 | NuclAT_0 | - | Antitoxin |
KJP47_RS09675 (1867037) | 1867037..1867213 | + | 177 | WP_213383384.1 | hypothetical protein | Toxin |
KJP47_RS09680 (1867232) | 1867232..1867483 | + | 252 | WP_213383383.1 | hypothetical protein | - |
KJP47_RS09685 (1867528) | 1867528..1867718 | + | 191 | Protein_1852 | hypothetical protein | - |
KJP47_RS09690 (1867800) | 1867800..1869000 | + | 1201 | Protein_1853 | hypothetical protein | - |
KJP47_RS09695 (1869337) | 1869337..1871205 | + | 1869 | WP_213383382.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1795580..1975429 | 179849 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6936.48 Da Isoelectric Point: 12.6965
>T296902 WP_213383384.1 NZ_OX419577:1867037-1867213 [Bacillus subtilis]
VLEKVGIIVAFLISLTVLTINSLTIVEKVRNLKNETSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIIVAFLISLTVLTINSLTIVEKVRNLKNETSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT296902 NZ_OX419577:c1867096-1866996 [Bacillus subtilis]
GATTGTTAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTTAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|