Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | bsrG-as-bsrG/- |
| Location | 2325359..2325655 | Replicon | chromosome |
| Accession | NZ_OX419573 | ||
| Organism | Bacillus subtilis isolate NRS6085 | ||
Toxin (Protein)
| Gene name | bsrG | Uniprot ID | L8EAY0 |
| Locus tag | KJP57_RS12095 | Protein ID | WP_009967548.1 |
| Coordinates | 2325359..2325475 (+) | Length | 39 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrG | ||
| Locus tag | - | ||
| Coordinates | 2325470..2325655 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP57_RS12065 (2320822) | 2320822..2322042 | - | 1221 | WP_213408345.1 | MFS transporter | - |
| KJP57_RS12070 (2322172) | 2322172..2323422 | - | 1251 | WP_213408347.1 | UV damage repair protein UvrX | - |
| KJP57_RS12075 (2323415) | 2323415..2323747 | - | 333 | WP_213408349.1 | YolD-like family protein | - |
| KJP57_RS12080 (2323921) | 2323921..2324256 | + | 336 | WP_213408351.1 | hypothetical protein | - |
| KJP57_RS12085 (2324299) | 2324299..2324655 | - | 357 | WP_213408353.1 | hypothetical protein | - |
| KJP57_RS12090 (2324661) | 2324661..2325128 | - | 468 | WP_019712873.1 | YolA family protein | - |
| KJP57_RS12095 (2325359) | 2325359..2325475 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
| - (2325470) | 2325470..2325655 | - | 186 | NuclAT_0 | - | Antitoxin |
| - (2325470) | 2325470..2325655 | - | 186 | NuclAT_0 | - | Antitoxin |
| - (2325470) | 2325470..2325655 | - | 186 | NuclAT_0 | - | Antitoxin |
| - (2325470) | 2325470..2325655 | - | 186 | NuclAT_0 | - | Antitoxin |
| KJP57_RS12100 (2325760) | 2325760..2326293 | - | 534 | WP_213408355.1 | GNAT family protein | - |
| KJP57_RS12105 (2326329) | 2326329..2326904 | - | 576 | WP_213408357.1 | SMI1/KNR4 family protein | - |
| KJP57_RS12110 (2326960) | 2326960..2327418 | - | 459 | WP_213408358.1 | YrhA family protein | - |
| KJP57_RS12115 (2327431) | 2327431..2329317 | - | 1887 | WP_213408360.1 | T7SS effector LXG polymorphic toxin | - |
| KJP57_RS12120 (2329487) | 2329487..2329984 | - | 498 | WP_213408362.1 | SMI1/KNR4 family protein | - |
| KJP57_RS12125 (2330072) | 2330072..2330325 | - | 254 | Protein_2338 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2199717..2336426 | 136709 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T296884 WP_009967548.1 NZ_OX419573:2325359-2325475 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
Antitoxin
Download Length: 186 bp
>AT296884 NZ_OX419573:c2325655-2325470 [Bacillus subtilis]
AATGATACAAATAATTATTTATTGCATTTTGATTTGTGGAAATGCATAAAATAAAAAAGACCTGGGGTGCGCTAACACCC
ACTGGTCATTGTTTGTACAAAAAGCCGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGT
GTCCAAACTCAAGGGAAGGTCTATTT
AATGATACAAATAATTATTTATTGCATTTTGATTTGTGGAAATGCATAAAATAAAAAAGACCTGGGGTGCGCTAACACCC
ACTGGTCATTGTTTGTACAAAAAGCCGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGT
GTCCAAACTCAAGGGAAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
