Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2621161..2621486 | Replicon | chromosome |
| Accession | NZ_OX419570 | ||
| Organism | Bacillus subtilis isolate NRS6134 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | P54373 |
| Locus tag | KJP59_RS13620 | Protein ID | WP_004398662.1 |
| Coordinates | 2621161..2621340 (+) | Length | 60 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2621264..2621486 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP59_RS13610 (2620387) | 2620387..2620524 | - | 138 | WP_003229934.1 | hypothetical protein | - |
| KJP59_RS13615 (2620566) | 2620566..2621015 | - | 450 | WP_003229933.1 | phage portal protein | - |
| KJP59_RS13620 (2621161) | 2621161..2621340 | + | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
| - (2621264) | 2621264..2621486 | - | 223 | NuclAT_0 | - | Antitoxin |
| - (2621264) | 2621264..2621486 | - | 223 | NuclAT_0 | - | Antitoxin |
| - (2621264) | 2621264..2621486 | - | 223 | NuclAT_0 | - | Antitoxin |
| - (2621264) | 2621264..2621486 | - | 223 | NuclAT_0 | - | Antitoxin |
| KJP59_RS13625 (2621720) | 2621720..2621809 | + | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| KJP59_RS13630 (2622063) | 2622063..2622506 | - | 444 | WP_003229930.1 | phage tail tube protein | - |
| KJP59_RS13635 (2622509) | 2622509..2623909 | - | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| KJP59_RS13640 (2623910) | 2623910..2624101 | - | 192 | WP_010886574.1 | hypothetical protein | - |
| KJP59_RS13645 (2624098) | 2624098..2624535 | - | 438 | WP_003229927.1 | hypothetical protein | - |
| KJP59_RS13650 (2624548) | 2624548..2625051 | - | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| KJP59_RS13655 (2625048) | 2625048..2625410 | - | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| KJP59_RS13660 (2625407) | 2625407..2625802 | - | 396 | WP_004398566.1 | DUF3199 family protein | - |
| KJP59_RS13665 (2625806) | 2625806..2626117 | - | 312 | WP_063694975.1 | YqbF domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2595914..2661097 | 65183 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T296869 WP_004398662.1 NZ_OX419570:2621161-2621340 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT296869 NZ_OX419570:c2621486-2621264 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
