Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | bsrG-SR6/- |
Location | 2255916..2256205 | Replicon | chromosome |
Accession | NZ_OX419564 | ||
Organism | Bacillus subtilis isolate NRS6127 |
Toxin (Protein)
Gene name | bsrG | Uniprot ID | L8EAY0 |
Locus tag | KJP48_RS11670 | Protein ID | WP_009967548.1 |
Coordinates | 2255916..2256032 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2256027..2256205 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP48_RS11640 (2251377) | 2251377..2252615 | - | 1239 | WP_142743355.1 | MFS transporter | - |
KJP48_RS11645 (2252728) | 2252728..2253978 | - | 1251 | WP_114168635.1 | UV damage repair protein UvrX | - |
KJP48_RS11650 (2253971) | 2253971..2254303 | - | 333 | WP_119996914.1 | YolD-like family protein | - |
KJP48_RS11655 (2254477) | 2254477..2254812 | + | 336 | WP_213386198.1 | hypothetical protein | - |
KJP48_RS11660 (2254855) | 2254855..2255211 | - | 357 | WP_213386197.1 | hypothetical protein | - |
KJP48_RS11665 (2255217) | 2255217..2255684 | - | 468 | WP_213386196.1 | DUF4879 domain-containing protein | - |
KJP48_RS11670 (2255916) | 2255916..2256032 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
- (2256027) | 2256027..2256205 | - | 179 | NuclAT_1 | - | Antitoxin |
- (2256027) | 2256027..2256205 | - | 179 | NuclAT_1 | - | Antitoxin |
- (2256027) | 2256027..2256205 | - | 179 | NuclAT_1 | - | Antitoxin |
- (2256027) | 2256027..2256205 | - | 179 | NuclAT_1 | - | Antitoxin |
KJP48_RS11675 (2256310) | 2256310..2256843 | - | 534 | WP_163260209.1 | GNAT family protein | - |
KJP48_RS11680 (2256879) | 2256879..2257457 | - | 579 | WP_069322724.1 | SMI1/KNR4 family protein | - |
KJP48_RS11685 (2257513) | 2257513..2257974 | - | 462 | WP_042976288.1 | SMI1/KNR4 family protein | - |
KJP48_RS11690 (2257990) | 2257990..2259755 | - | 1766 | Protein_2251 | T7SS effector LXG polymorphic toxin | - |
KJP48_RS11695 (2260007) | 2260007..2261008 | + | 1002 | WP_250628844.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2132614..2265676 | 133062 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T296828 WP_009967548.1 NZ_OX419564:2255916-2256032 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
Antitoxin
Download Length: 179 bp
>AT296828 NZ_OX419564:c2256205-2256027 [Bacillus subtilis]
AATGATACAAATAATTATTTTTTGCATTTTGATTTGTAGAAATGCATAAAATAAAAAGACCAGGGTGCTACCAACACCCC
AGCTCTGTACAAAAAGCTGCCCATCAAAGGGCTTGCTCAGATGTATGTGACATAGTAGACCAACCCTTTAGGGTCGCAAT
CTCAAGGGGAGGTCTATTT
AATGATACAAATAATTATTTTTTGCATTTTGATTTGTAGAAATGCATAAAATAAAAAGACCAGGGTGCTACCAACACCCC
AGCTCTGTACAAAAAGCTGCCCATCAAAGGGCTTGCTCAGATGTATGTGACATAGTAGACCAACCCTTTAGGGTCGCAAT
CTCAAGGGGAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|