Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) yonT-as-bsrH/-
Location 2205192..2205409 Replicon chromosome
Accession NZ_OX419564
Organism Bacillus subtilis isolate NRS6127

Toxin (Protein)


Gene name yonT Uniprot ID A0A6H0WKE8
Locus tag KJP48_RS11415 Protein ID WP_032721653.1
Coordinates 2205192..2205368 (-) Length 59 a.a.

Antitoxin (RNA)


Gene name as-bsrH
Locus tag -
Coordinates 2205309..2205409 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KJP48_RS11370 (2200705) 2200705..2201259 - 555 WP_213386207.1 hypothetical protein -
KJP48_RS11375 (2201568) 2201568..2201933 - 366 WP_213386206.1 hypothetical protein -
KJP48_RS11380 (2201967) 2201967..2202236 - 270 WP_006640590.1 hypothetical protein -
KJP48_RS11385 (2202268) 2202268..2202471 - 204 WP_213386204.1 hypothetical protein -
KJP48_RS11390 (2202535) 2202535..2202738 - 204 WP_213386203.1 hypothetical protein -
KJP48_RS11395 (2202831) 2202831..2203076 - 246 WP_144500927.1 hypothetical protein -
KJP48_RS11400 (2203390) 2203390..2204607 - 1218 WP_144500928.1 hypothetical protein -
KJP48_RS11405 (2204689) 2204689..2204877 - 189 WP_003230987.1 hypothetical protein -
KJP48_RS11410 (2204922) 2204922..2205173 - 252 WP_134853524.1 hypothetical protein -
KJP48_RS11415 (2205192) 2205192..2205368 - 177 WP_032721653.1 hypothetical protein Toxin
- (2205309) 2205309..2205409 + 101 NuclAT_0 - Antitoxin
- (2205309) 2205309..2205409 + 101 NuclAT_0 - Antitoxin
- (2205309) 2205309..2205409 + 101 NuclAT_0 - Antitoxin
- (2205309) 2205309..2205409 + 101 NuclAT_0 - Antitoxin
KJP48_RS11420 (2206317) 2206317..2206511 + 195 WP_072692657.1 hypothetical protein -
KJP48_RS11425 (2206551) 2206551..2209058 + 2508 WP_213393208.1 hypothetical protein -
KJP48_RS11430 (2209322) 2209322..2209597 + 276 WP_144500930.1 HU family DNA-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2132614..2265676 133062


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6850.39 Da        Isoelectric Point: 12.8833

>T296824 WP_032721653.1 NZ_OX419564:c2205368-2205192 [Bacillus subtilis]
VLEKVGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR

Download         Length: 177 bp

Antitoxin


Download         Length: 101 bp

>AT296824 NZ_OX419564:2205309-2205409 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6H0WKE8

Antitoxin

Download structure file

References