Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2205151..2205368 | Replicon | chromosome |
Accession | NZ_OX419564 | ||
Organism | Bacillus subtilis isolate NRS6127 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | A0A6H0WKE8 |
Locus tag | KJP48_RS11415 | Protein ID | WP_032721653.1 |
Coordinates | 2205192..2205368 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2205151..2205251 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP48_RS11370 | 2200705..2201259 | - | 555 | WP_213386207.1 | hypothetical protein | - |
KJP48_RS11375 | 2201568..2201933 | - | 366 | WP_213386206.1 | hypothetical protein | - |
KJP48_RS11380 | 2201967..2202236 | - | 270 | WP_006640590.1 | hypothetical protein | - |
KJP48_RS11385 | 2202268..2202471 | - | 204 | WP_213386204.1 | hypothetical protein | - |
KJP48_RS11390 | 2202535..2202738 | - | 204 | WP_213386203.1 | hypothetical protein | - |
KJP48_RS11395 | 2202831..2203076 | - | 246 | WP_144500927.1 | hypothetical protein | - |
KJP48_RS11400 | 2203390..2204607 | - | 1218 | WP_144500928.1 | hypothetical protein | - |
KJP48_RS11405 | 2204689..2204877 | - | 189 | WP_003230987.1 | hypothetical protein | - |
KJP48_RS11410 | 2204922..2205173 | - | 252 | WP_134853524.1 | hypothetical protein | - |
- | 2205151..2205251 | + | 101 | - | - | Antitoxin |
KJP48_RS11415 | 2205192..2205368 | - | 177 | WP_032721653.1 | hypothetical protein | Toxin |
- | 2205309..2205409 | + | 101 | NuclAT_0 | - | - |
- | 2205309..2205409 | + | 101 | NuclAT_0 | - | - |
- | 2205309..2205409 | + | 101 | NuclAT_0 | - | - |
- | 2205309..2205409 | + | 101 | NuclAT_0 | - | - |
KJP48_RS11420 | 2206317..2206511 | + | 195 | WP_072692657.1 | hypothetical protein | - |
KJP48_RS11425 | 2206551..2209058 | + | 2508 | WP_213393208.1 | hypothetical protein | - |
KJP48_RS11430 | 2209322..2209597 | + | 276 | WP_144500930.1 | HU family DNA-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2132614..2265676 | 133062 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6850.39 Da Isoelectric Point: 12.8833
>T296822 WP_032721653.1 NZ_OX419564:c2205368-2205192 [Bacillus subtilis]
VLEKVGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT296822 NZ_OX419564:2205151-2205251 [Bacillus subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|