Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | bsrE-as-bsrE/- |
Location | 2165206..2165452 | Replicon | chromosome |
Accession | NZ_OX419563 | ||
Organism | Bacillus subtilis isolate NRS6153 |
Toxin (Protein)
Gene name | bsrE | Uniprot ID | - |
Locus tag | KJP66_RS11020 | Protein ID | WP_109789044.1 |
Coordinates | 2165206..2165298 (+) | Length | 31 a.a. |
Antitoxin (RNA)
Gene name | as-bsrE | ||
Locus tag | - | ||
Coordinates | 2165279..2165452 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP66_RS11005 | 2160365..2160700 | + | 336 | WP_009967409.1 | hypothetical protein | - |
KJP66_RS11010 | 2160747..2164352 | - | 3606 | WP_004399367.1 | P-loop NTPase fold protein | - |
KJP66_RS11015 | 2164585..2164917 | - | 333 | WP_026009814.1 | hypothetical protein | - |
KJP66_RS11020 | 2165206..2165298 | + | 93 | WP_109789044.1 | type I toxin-antitoxin system toxin BsrE | Toxin |
- | 2165279..2165452 | - | 174 | - | - | Antitoxin |
KJP66_RS11025 | 2165567..2166409 | - | 843 | WP_003231327.1 | hypothetical protein | - |
KJP66_RS11030 | 2166609..2167067 | - | 459 | WP_003231326.1 | type VII secretion system immunity protein YobK | - |
KJP66_RS11035 | 2167077..2168879 | - | 1803 | WP_004399481.1 | LXG family T7SS effector ribonuclease toxin YobL | - |
KJP66_RS11040 | 2168981..2169538 | - | 558 | WP_004399321.1 | SMI1/KNR4 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2151601..2174869 | 23268 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 31 a.a. Molecular weight: 3358.16 Da Isoelectric Point: 4.1840
>T296811 WP_109789044.1 NZ_OX419563:2165206-2165298 [Bacillus subtilis]
MSTFQALMLMLAIGSFIIALLTYIEKIDLP
MSTFQALMLMLAIGSFIIALLTYIEKIDLP
Download Length: 93 bp
Antitoxin
Download Length: 174 bp
>AT296811 NZ_OX419563:c2165452-2165279 [Bacillus subtilis]
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|