Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | bsrG-SR6/- |
Location | 2262271..2262560 | Replicon | chromosome |
Accession | NZ_OX419557 | ||
Organism | Bacillus subtilis isolate NRS6186 |
Toxin (Protein)
Gene name | bsrG | Uniprot ID | L8EAY0 |
Locus tag | KJP72_RS11735 | Protein ID | WP_009967548.1 |
Coordinates | 2262271..2262387 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2262382..2262560 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP72_RS11705 (2257732) | 2257732..2258970 | - | 1239 | WP_142743355.1 | MFS transporter | - |
KJP72_RS11710 (2259083) | 2259083..2260333 | - | 1251 | WP_114168635.1 | UV damage repair protein UvrX | - |
KJP72_RS11715 (2260326) | 2260326..2260658 | - | 333 | WP_119996914.1 | YolD-like family protein | - |
KJP72_RS11720 (2260832) | 2260832..2261167 | + | 336 | WP_213386198.1 | hypothetical protein | - |
KJP72_RS11725 (2261210) | 2261210..2261566 | - | 357 | WP_213386197.1 | hypothetical protein | - |
KJP72_RS11730 (2261572) | 2261572..2262039 | - | 468 | WP_213386196.1 | DUF4879 domain-containing protein | - |
KJP72_RS11735 (2262271) | 2262271..2262387 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
- (2262382) | 2262382..2262560 | - | 179 | NuclAT_1 | - | Antitoxin |
- (2262382) | 2262382..2262560 | - | 179 | NuclAT_1 | - | Antitoxin |
- (2262382) | 2262382..2262560 | - | 179 | NuclAT_1 | - | Antitoxin |
- (2262382) | 2262382..2262560 | - | 179 | NuclAT_1 | - | Antitoxin |
KJP72_RS11740 (2262665) | 2262665..2263198 | - | 534 | WP_163260209.1 | GNAT family protein | - |
KJP72_RS11745 (2263234) | 2263234..2263812 | - | 579 | WP_069322724.1 | SMI1/KNR4 family protein | - |
KJP72_RS11750 (2263868) | 2263868..2264329 | - | 462 | WP_042976288.1 | SMI1/KNR4 family protein | - |
KJP72_RS11755 (2264345) | 2264345..2266110 | - | 1766 | Protein_2264 | T7SS effector LXG polymorphic toxin | - |
KJP72_RS11760 (2266362) | 2266362..2267363 | + | 1002 | WP_250628844.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2138968..2272031 | 133063 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T296801 WP_009967548.1 NZ_OX419557:2262271-2262387 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
Antitoxin
Download Length: 179 bp
>AT296801 NZ_OX419557:c2262560-2262382 [Bacillus subtilis]
AATGATACAAATAATTATTTTTTGCATTTTGATTTGTAGAAATGCATAAAATAAAAAGACCAGGGTGCTACCAACACCCC
AGCTCTGTACAAAAAGCTGCCCATCAAAGGGCTTGCTCAGATGTATGTGACATAGTAGACCAACCCTTTAGGGTCGCAAT
CTCAAGGGGAGGTCTATTT
AATGATACAAATAATTATTTTTTGCATTTTGATTTGTAGAAATGCATAAAATAAAAAGACCAGGGTGCTACCAACACCCC
AGCTCTGTACAAAAAGCTGCCCATCAAAGGGCTTGCTCAGATGTATGTGACATAGTAGACCAACCCTTTAGGGTCGCAAT
CTCAAGGGGAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|