Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2211506..2211723 | Replicon | chromosome |
Accession | NZ_OX419557 | ||
Organism | Bacillus subtilis isolate NRS6186 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | A0A6H0WKE8 |
Locus tag | KJP72_RS11480 | Protein ID | WP_032721653.1 |
Coordinates | 2211547..2211723 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2211506..2211606 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP72_RS11435 | 2207060..2207614 | - | 555 | WP_213386207.1 | hypothetical protein | - |
KJP72_RS11440 | 2207923..2208288 | - | 366 | WP_213386206.1 | hypothetical protein | - |
KJP72_RS11445 | 2208322..2208591 | - | 270 | WP_006640590.1 | hypothetical protein | - |
KJP72_RS11450 | 2208623..2208826 | - | 204 | WP_213386204.1 | hypothetical protein | - |
KJP72_RS11455 | 2208890..2209093 | - | 204 | WP_213386203.1 | hypothetical protein | - |
KJP72_RS11460 | 2209186..2209431 | - | 246 | WP_144500927.1 | hypothetical protein | - |
KJP72_RS11465 | 2209745..2210962 | - | 1218 | WP_144500928.1 | hypothetical protein | - |
KJP72_RS11470 | 2211044..2211232 | - | 189 | WP_003230987.1 | hypothetical protein | - |
KJP72_RS11475 | 2211277..2211528 | - | 252 | WP_134853524.1 | hypothetical protein | - |
- | 2211506..2211606 | + | 101 | - | - | Antitoxin |
KJP72_RS11480 | 2211547..2211723 | - | 177 | WP_032721653.1 | hypothetical protein | Toxin |
- | 2211664..2211764 | + | 101 | NuclAT_0 | - | - |
- | 2211664..2211764 | + | 101 | NuclAT_0 | - | - |
- | 2211664..2211764 | + | 101 | NuclAT_0 | - | - |
- | 2211664..2211764 | + | 101 | NuclAT_0 | - | - |
KJP72_RS11485 | 2212672..2212866 | + | 195 | WP_072692657.1 | hypothetical protein | - |
KJP72_RS11490 | 2212906..2215413 | + | 2508 | WP_213386202.1 | hypothetical protein | - |
KJP72_RS11495 | 2215677..2215952 | + | 276 | WP_144500930.1 | HU family DNA-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2138968..2272031 | 133063 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6850.39 Da Isoelectric Point: 12.8833
>T296795 WP_032721653.1 NZ_OX419557:c2211723-2211547 [Bacillus subtilis]
VLEKVGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT296795 NZ_OX419557:2211506-2211606 [Bacillus subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|