Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | yonT-as-bsrH/- |
| Location | 2222116..2222333 | Replicon | chromosome |
| Accession | NZ_OX419554 | ||
| Organism | Bacillus subtilis isolate NRS6160 | ||
Toxin (Protein)
| Gene name | yonT | Uniprot ID | - |
| Locus tag | KJP77_RS11500 | Protein ID | WP_017696861.1 |
| Coordinates | 2222116..2222292 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrH | ||
| Locus tag | - | ||
| Coordinates | 2222233..2222333 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP77_RS11455 (2217350) | 2217350..2217583 | - | 234 | WP_019712282.1 | hypothetical protein | - |
| KJP77_RS11460 (2217656) | 2217656..2217877 | - | 222 | WP_213416140.1 | helix-turn-helix transcriptional regulator | - |
| KJP77_RS11465 (2217975) | 2217975..2218142 | - | 168 | WP_172480897.1 | hypothetical protein | - |
| KJP77_RS11470 (2218379) | 2218379..2218933 | - | 555 | WP_144453785.1 | hypothetical protein | - |
| KJP77_RS11475 (2219239) | 2219239..2219472 | - | 234 | WP_144452913.1 | hypothetical protein | - |
| KJP77_RS11480 (2219556) | 2219556..2219843 | - | 288 | WP_144452911.1 | hypothetical protein | - |
| KJP77_RS11485 (2220310) | 2220310..2221527 | - | 1218 | WP_213416141.1 | hypothetical protein | - |
| KJP77_RS11490 (2221640) | 2221640..2221801 | - | 162 | WP_106293942.1 | hypothetical protein | - |
| KJP77_RS11495 (2221846) | 2221846..2222097 | - | 252 | WP_080010576.1 | hypothetical protein | - |
| KJP77_RS11500 (2222116) | 2222116..2222292 | - | 177 | WP_017696861.1 | hypothetical protein | Toxin |
| - (2222233) | 2222233..2222333 | + | 101 | NuclAT_0 | - | Antitoxin |
| - (2222233) | 2222233..2222333 | + | 101 | NuclAT_0 | - | Antitoxin |
| - (2222233) | 2222233..2222333 | + | 101 | NuclAT_0 | - | Antitoxin |
| - (2222233) | 2222233..2222333 | + | 101 | NuclAT_0 | - | Antitoxin |
| KJP77_RS11505 (2223250) | 2223250..2223444 | + | 195 | WP_032721649.1 | hypothetical protein | - |
| KJP77_RS11510 (2223484) | 2223484..2226009 | + | 2526 | WP_032721648.1 | hypothetical protein | - |
| KJP77_RS11515 (2226262) | 2226262..2226537 | + | 276 | WP_032721646.1 | HU family DNA-binding protein | - |
| KJP77_RS11520 (2226549) | 2226549..2226719 | + | 171 | WP_128472249.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2153489..2283978 | 130489 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6878.45 Da Isoelectric Point: 12.8833
>T296784 WP_017696861.1 NZ_OX419554:c2222292-2222116 [Bacillus subtilis]
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT296784 NZ_OX419554:2222233-2222333 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
