Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2222075..2222292 | Replicon | chromosome |
Accession | NZ_OX419554 | ||
Organism | Bacillus subtilis isolate NRS6160 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | - |
Locus tag | KJP77_RS11500 | Protein ID | WP_017696861.1 |
Coordinates | 2222116..2222292 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2222075..2222175 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP77_RS11455 | 2217350..2217583 | - | 234 | WP_019712282.1 | hypothetical protein | - |
KJP77_RS11460 | 2217656..2217877 | - | 222 | WP_213416140.1 | helix-turn-helix transcriptional regulator | - |
KJP77_RS11465 | 2217975..2218142 | - | 168 | WP_172480897.1 | hypothetical protein | - |
KJP77_RS11470 | 2218379..2218933 | - | 555 | WP_144453785.1 | hypothetical protein | - |
KJP77_RS11475 | 2219239..2219472 | - | 234 | WP_144452913.1 | hypothetical protein | - |
KJP77_RS11480 | 2219556..2219843 | - | 288 | WP_144452911.1 | hypothetical protein | - |
KJP77_RS11485 | 2220310..2221527 | - | 1218 | WP_213416141.1 | hypothetical protein | - |
KJP77_RS11490 | 2221640..2221801 | - | 162 | WP_106293942.1 | hypothetical protein | - |
KJP77_RS11495 | 2221846..2222097 | - | 252 | WP_080010576.1 | hypothetical protein | - |
- | 2222075..2222175 | + | 101 | - | - | Antitoxin |
KJP77_RS11500 | 2222116..2222292 | - | 177 | WP_017696861.1 | hypothetical protein | Toxin |
- | 2222233..2222333 | + | 101 | NuclAT_0 | - | - |
- | 2222233..2222333 | + | 101 | NuclAT_0 | - | - |
- | 2222233..2222333 | + | 101 | NuclAT_0 | - | - |
- | 2222233..2222333 | + | 101 | NuclAT_0 | - | - |
KJP77_RS11505 | 2223250..2223444 | + | 195 | WP_032721649.1 | hypothetical protein | - |
KJP77_RS11510 | 2223484..2226009 | + | 2526 | WP_032721648.1 | hypothetical protein | - |
KJP77_RS11515 | 2226262..2226537 | + | 276 | WP_032721646.1 | HU family DNA-binding protein | - |
KJP77_RS11520 | 2226549..2226719 | + | 171 | WP_128472249.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2153489..2283978 | 130489 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6878.45 Da Isoelectric Point: 12.8833
>T296782 WP_017696861.1 NZ_OX419554:c2222292-2222116 [Bacillus subtilis]
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT296782 NZ_OX419554:2222075-2222175 [Bacillus subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|