Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | yonT-SR6/- |
| Location | 1904061..1904548 | Replicon | chromosome |
| Accession | NZ_OX419553 | ||
| Organism | Bacillus subtilis isolate NRS6183 | ||
Toxin (Protein)
| Gene name | yonT | Uniprot ID | - |
| Locus tag | KJP78_RS09610 | Protein ID | WP_080010576.1 |
| Coordinates | 1904297..1904548 (+) | Length | 84 a.a. |
Antitoxin (RNA)
| Gene name | SR6 | ||
| Locus tag | - | ||
| Coordinates | 1904061..1904161 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP78_RS09585 (1899089) | 1899089..1899260 | - | 172 | Protein_1832 | hypothetical protein | - |
| KJP78_RS09590 (1899867) | 1899867..1900145 | - | 279 | WP_004399274.1 | HU-related DNA-binding protein HupN | - |
| KJP78_RS09595 (1900388) | 1900388..1902907 | - | 2520 | WP_213416700.1 | DNA-directed RNA polymerase YonO | - |
| KJP78_RS09600 (1902947) | 1902947..1903141 | - | 195 | WP_004399291.1 | hypothetical protein | - |
| - (1904061) | 1904061..1904161 | - | 101 | NuclAT_0 | - | Antitoxin |
| - (1904061) | 1904061..1904161 | - | 101 | NuclAT_0 | - | Antitoxin |
| - (1904061) | 1904061..1904161 | - | 101 | NuclAT_0 | - | Antitoxin |
| - (1904061) | 1904061..1904161 | - | 101 | NuclAT_0 | - | Antitoxin |
| KJP78_RS09605 (1904102) | 1904102..1904278 | + | 177 | WP_019712271.1 | hypothetical protein | - |
| KJP78_RS09610 (1904297) | 1904297..1904548 | + | 252 | WP_080010576.1 | hypothetical protein | Toxin |
| KJP78_RS09615 (1904593) | 1904593..1904781 | + | 189 | WP_213416699.1 | hypothetical protein | - |
| KJP78_RS09620 (1904898) | 1904898..1905743 | + | 846 | WP_213416698.1 | GIY-YIG nuclease family protein | - |
| KJP78_RS09625 (1905762) | 1905762..1906979 | + | 1218 | WP_213416697.1 | hypothetical protein | - |
| KJP78_RS09630 (1907310) | 1907310..1909181 | + | 1872 | WP_213416696.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1838965..2012799 | 173834 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 10071.13 Da Isoelectric Point: 10.0301
>T296772 WP_080010576.1 NZ_OX419553:1904297-1904548 [Bacillus subtilis]
MNFSFSSYPYYNMIKHIANMKRFSLWFTHITFIGLFLMFQLIKDYFSSEAQTLINIIFIVTCIIAILLWIIYFVFLKLRN
KSH
MNFSFSSYPYYNMIKHIANMKRFSLWFTHITFIGLFLMFQLIKDYFSSEAQTLINIIFIVTCIIAILLWIIYFVFLKLRN
KSH
Download Length: 252 bp
Antitoxin
Download Length: 101 bp
>AT296772 NZ_OX419553:c1904161-1904061 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|