Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
| Location | 2005968..2006601 | Replicon | chromosome |
| Accession | NZ_OX411212 | ||
| Organism | Vibrio campbellii isolate BF5_0283 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A347UQS4 |
| Locus tag | QMX76_RS09895 | Protein ID | WP_012600340.1 |
| Coordinates | 2006269..2006601 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QMX76_RS09890 | Protein ID | WP_017049537.1 |
| Coordinates | 2005968..2006282 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMX76_RS09850 | 2001616..2002047 | - | 432 | WP_005536215.1 | hypothetical protein | - |
| QMX76_RS09855 | 2002184..2002639 | - | 456 | WP_282249272.1 | GNAT family N-acetyltransferase | - |
| QMX76_RS09860 | 2002756..2003256 | - | 501 | WP_282249273.1 | GNAT family N-acetyltransferase | - |
| QMX76_RS09865 | 2003402..2003899 | - | 498 | WP_282249274.1 | GNAT family N-acetyltransferase | - |
| QMX76_RS09870 | 2003927..2004016 | - | 90 | WP_073514058.1 | DUF3265 domain-containing protein | - |
| QMX76_RS09875 | 2004548..2004637 | - | 90 | WP_080286084.1 | DUF3265 domain-containing protein | - |
| QMX76_RS09880 | 2005283..2005840 | - | 558 | WP_282249275.1 | nucleotidyltransferase family protein | - |
| QMX76_RS09885 | 2005861..2005953 | - | 93 | WP_080102040.1 | DUF3265 domain-containing protein | - |
| QMX76_RS09890 | 2005968..2006282 | - | 315 | WP_017049537.1 | DNA-binding transcriptional regulator | Antitoxin |
| QMX76_RS09895 | 2006269..2006601 | - | 333 | WP_012600340.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QMX76_RS09900 | 2006704..2006796 | - | 93 | WP_079855829.1 | DUF3265 domain-containing protein | - |
| QMX76_RS09905 | 2006811..2007323 | - | 513 | WP_231571918.1 | GNAT family N-acetyltransferase | - |
| QMX76_RS09910 | 2007457..2008014 | - | 558 | WP_282249276.1 | cysteine hydrolase | - |
| QMX76_RS09915 | 2008044..2008133 | - | 90 | WP_079852034.1 | DUF3265 domain-containing protein | - |
| QMX76_RS09920 | 2008151..2008528 | - | 378 | WP_282249277.1 | hypothetical protein | - |
| QMX76_RS09925 | 2008564..2008653 | - | 90 | WP_072609597.1 | DUF3265 domain-containing protein | - |
| QMX76_RS09930 | 2008684..2009037 | - | 354 | WP_282249278.1 | DUF6404 family protein | - |
| QMX76_RS09935 | 2009089..2009180 | - | 92 | Protein_1884 | DUF3265 domain-containing protein | - |
| QMX76_RS09940 | 2009233..2009994 | - | 762 | WP_282249279.1 | nucleotidyltransferase domain-containing protein | - |
| QMX76_RS09945 | 2010112..2011137 | - | 1026 | WP_282249280.1 | LD-carboxypeptidase | - |
| QMX76_RS09950 | 2011163..2011255 | - | 93 | WP_282249281.1 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1980022..2048688 | 68666 | |
| - | inside | Integron | - | - | 1992543..2039497 | 46954 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12906.76 Da Isoelectric Point: 10.0960
>T296747 WP_012600340.1 NZ_OX411212:c2006601-2006269 [Vibrio campbellii]
MKSVFVESTIFEKYRNEYLSDDEFRLFQAELMSNPKQGDVIQGTGGLRKIRVASKGKGKRGGSRVIYYFLDEKRRFYLLT
IYGKNEMSDLTADQKKQLKAFMEAWRNEQS
MKSVFVESTIFEKYRNEYLSDDEFRLFQAELMSNPKQGDVIQGTGGLRKIRVASKGKGKRGGSRVIYYFLDEKRRFYLLT
IYGKNEMSDLTADQKKQLKAFMEAWRNEQS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|