Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3986059..3986735 | Replicon | chromosome |
| Accession | NZ_OX371412 | ||
| Organism | Streptomyces albidoflavus strain CCOS 2040 isolate Stup19_F108 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | - |
| Locus tag | OZE77_RS17560 | Protein ID | WP_018471256.1 |
| Coordinates | 3986059..3986421 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OZE77_RS17565 | Protein ID | WP_018471255.1 |
| Coordinates | 3986418..3986735 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZE77_RS17535 (CCOS2040_17650) | 3982080..3982496 | - | 417 | WP_003949884.1 | ATP-binding protein | - |
| OZE77_RS17540 (CCOS2040_17655) | 3982496..3982876 | - | 381 | WP_003949885.1 | STAS domain-containing protein | - |
| OZE77_RS17545 (CCOS2040_17660) | 3982873..3983727 | - | 855 | WP_030308234.1 | STAS domain-containing protein | - |
| OZE77_RS17550 (CCOS2040_17665) | 3984031..3984273 | + | 243 | WP_030308232.1 | hypothetical protein | - |
| OZE77_RS17555 (CCOS2040_17670) | 3984363..3986060 | - | 1698 | WP_031177816.1 | hypothetical protein | - |
| OZE77_RS17560 | 3986059..3986421 | + | 363 | WP_018471256.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OZE77_RS17565 (CCOS2040_17675) | 3986418..3986735 | + | 318 | WP_018471255.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OZE77_RS17570 (CCOS2040_17680) | 3986814..3987596 | - | 783 | WP_003949890.1 | ABC transporter permease | - |
| OZE77_RS17575 (CCOS2040_17685) | 3987593..3988567 | - | 975 | WP_003949891.1 | daunorubicin resistance protein DrrA family ABC transporter ATP-binding protein | - |
| OZE77_RS17580 (CCOS2040_17690) | 3988671..3989540 | - | 870 | WP_267766697.1 | DUF4097 family beta strand repeat-containing protein | - |
| OZE77_RS17585 (CCOS2040_17695) | 3989642..3990172 | - | 531 | WP_003949893.1 | toxin-antitoxin system HicB family antitoxin | - |
| OZE77_RS17590 (CCOS2040_17700) | 3990368..3991429 | - | 1062 | WP_031177814.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13502.36 Da Isoelectric Point: 4.6168
>T296743 WP_018471256.1 NZ_OX371412:3986059-3986421 [Streptomyces albidoflavus]
MDGEWQIFLVDEVRVWLASLDGAAHARVVQALDVLAEEGPALGRPLVDTLRGSAVANLKELRPGTVRILFAFDPWRSSIL
LVAGDKSGQWTEWYQEAIPLAEQRYALYLKEREREEGGRP
MDGEWQIFLVDEVRVWLASLDGAAHARVVQALDVLAEEGPALGRPLVDTLRGSAVANLKELRPGTVRILFAFDPWRSSIL
LVAGDKSGQWTEWYQEAIPLAEQRYALYLKEREREEGGRP
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|