Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 5295226..5295915 | Replicon | chromosome |
Accession | NZ_OX359182 | ||
Organism | Klebsiella pneumoniae strain KP34 isolate 2018-347802-001-01 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A331C6E2 |
Locus tag | OM989_RS25440 | Protein ID | WP_021469727.1 |
Coordinates | 5295598..5295915 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6B0N7G3 |
Locus tag | OM989_RS25435 | Protein ID | WP_020804705.1 |
Coordinates | 5295226..5295522 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM989_RS25420 (5291618) | 5291618..5293000 | + | 1383 | WP_004151222.1 | MFS transporter | - |
OM989_RS25425 (5293044) | 5293044..5294660 | + | 1617 | WP_004175961.1 | carbohydrate porin | - |
OM989_RS25430 (5294701) | 5294701..5295147 | - | 447 | WP_032435212.1 | hypothetical protein | - |
OM989_RS25435 (5295226) | 5295226..5295522 | - | 297 | WP_020804705.1 | NadS family protein | Antitoxin |
OM989_RS25440 (5295598) | 5295598..5295915 | - | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OM989_RS25445 (5296122) | 5296122..5296349 | - | 228 | WP_002906690.1 | tautomerase PptA | - |
OM989_RS25450 (5296420) | 5296420..5297037 | - | 618 | WP_032425015.1 | glutathione S-transferase family protein | - |
OM989_RS25455 (5297115) | 5297115..5297966 | - | 852 | WP_072198177.1 | transporter substrate-binding domain-containing protein | - |
OM989_RS25460 (5298005) | 5298005..5298784 | - | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
OM989_RS25465 (5298768) | 5298768..5299694 | - | 927 | WP_032435210.1 | amino acid ABC transporter permease | - |
OM989_RS25470 (5299704) | 5299704..5300213 | - | 510 | WP_020802144.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T296727 WP_021469727.1 NZ_OX359182:c5295915-5295598 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331C6E2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B0N7G3 |