Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 2030628..2031214 Replicon chromosome
Accession NZ_OX359182
Organism Klebsiella pneumoniae strain KP34 isolate 2018-347802-001-01

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag OM989_RS09930 Protein ID WP_002920800.1
Coordinates 2030628..2030996 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OM989_RS09935 Protein ID WP_004174006.1
Coordinates 2030993..2031214 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM989_RS09910 (2026131) 2026131..2027201 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
OM989_RS09915 (2027203) 2027203..2028048 - 846 WP_032434559.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OM989_RS09920 (2028045) 2028045..2028932 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OM989_RS09925 (2029039) 2029039..2030355 - 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OM989_RS09930 (2030628) 2030628..2030996 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OM989_RS09935 (2030993) 2030993..2031214 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OM989_RS09940 (2031378) 2031378..2032091 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OM989_RS09945 (2032093) 2032093..2032860 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OM989_RS09950 (2032857) 2032857..2034134 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
OM989_RS09955 (2034131) 2034131..2035057 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2025394..2034134 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T296718 WP_002920800.1 NZ_OX359182:c2030996-2030628 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT296718 WP_004174006.1 NZ_OX359182:c2031214-2030993 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References