Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 2514595..2515284 | Replicon | chromosome |
| Accession | NZ_OX359175 | ||
| Organism | Klebsiella pneumoniae strain KP47 isolate 2018-047100-007-01 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A331C6E2 |
| Locus tag | ONI05_RS12325 | Protein ID | WP_021469727.1 |
| Coordinates | 2514595..2514912 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A6B0N7G3 |
| Locus tag | ONI05_RS12330 | Protein ID | WP_020804705.1 |
| Coordinates | 2514988..2515284 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONI05_RS12295 (2510297) | 2510297..2510806 | + | 510 | WP_020802144.1 | GNAT family N-acetyltransferase | - |
| ONI05_RS12300 (2510816) | 2510816..2511742 | + | 927 | WP_032435210.1 | amino acid ABC transporter permease | - |
| ONI05_RS12305 (2511726) | 2511726..2512505 | + | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
| ONI05_RS12310 (2512544) | 2512544..2513395 | + | 852 | WP_072198177.1 | transporter substrate-binding domain-containing protein | - |
| ONI05_RS12315 (2513473) | 2513473..2514090 | + | 618 | WP_032425015.1 | glutathione S-transferase family protein | - |
| ONI05_RS12320 (2514161) | 2514161..2514388 | + | 228 | WP_002906690.1 | tautomerase PptA | - |
| ONI05_RS12325 (2514595) | 2514595..2514912 | + | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ONI05_RS12330 (2514988) | 2514988..2515284 | + | 297 | WP_020804705.1 | NadS family protein | Antitoxin |
| ONI05_RS12335 (2515363) | 2515363..2515809 | + | 447 | WP_032435212.1 | hypothetical protein | - |
| ONI05_RS12340 (2515850) | 2515850..2517466 | - | 1617 | WP_004175961.1 | carbohydrate porin | - |
| ONI05_RS12345 (2517510) | 2517510..2518892 | - | 1383 | WP_004151222.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T296700 WP_021469727.1 NZ_OX359175:2514595-2514912 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A331C6E2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6B0N7G3 |