Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-RelB
Location 1759416..1759935 Replicon chromosome
Accession NZ_OX352996
Organism Streptococcus suis isolate 861160_dhsdS

Toxin (Protein)


Gene name yoeB Uniprot ID A0A2K1SXY6
Locus tag QNH80_RS08630 Protein ID WP_012775363.1
Coordinates 1759678..1759935 (+) Length 86 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A0K2E7Z9
Locus tag QNH80_RS08625 Protein ID WP_002939010.1
Coordinates 1759416..1759676 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QNH80_RS08585 1755071..1756066 + 996 WP_012775367.1 RNA-binding cell elongation regulator Jag/EloR -
QNH80_RS08590 1756234..1756371 + 138 WP_002939016.1 50S ribosomal protein L34 -
QNH80_RS08595 1756478..1757260 + 783 WP_012028536.1 TatD family hydrolase -
QNH80_RS08600 1757244..1757813 + 570 WP_012775700.1 ribonuclease M5 -
QNH80_RS08605 1757806..1758174 + 369 WP_012775453.1 hypothetical protein -
QNH80_RS08610 1758272..1758559 + 288 WP_012028535.1 hypothetical protein -
QNH80_RS08615 1758549..1758878 + 330 WP_012775364.1 type II toxin-antitoxin system RelE/ParE family toxin -
QNH80_RS08620 1758885..1759340 + 456 WP_074390181.1 8-oxo-dGTP diphosphatase -
QNH80_RS08625 1759416..1759676 + 261 WP_002939010.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QNH80_RS08630 1759678..1759935 + 258 WP_012775363.1 Txe/YoeB family addiction module toxin Toxin
QNH80_RS08635 1759949..1760479 + 531 WP_074390182.1 DUF1697 domain-containing protein -
QNH80_RS08640 1760498..1761370 + 873 WP_024387385.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QNH80_RS08645 1761550..1762023 + 474 WP_024378560.1 IS200/IS605 family transposase -
QNH80_RS08650 1762484..1764214 + 1731 WP_024387386.1 membrane protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1757244..1784328 27084
- flank IS/Tn - - 1761550..1762023 473


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(1-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10346.81 Da        Isoelectric Point: 7.2737

>T296690 WP_012775363.1 NZ_OX352996:1759678-1759935 [Streptococcus suis]
MGIHFTDDAWEDYLYWQGQDKKTLKRINKIIQDMQRHPFEGIAKPEPLKYDYQGAWSRRIDAENRLIYMVEADRLCILSL
KDHYR

Download         Length: 258 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9980.36 Da        Isoelectric Point: 5.7134

>AT296690 WP_002939010.1 NZ_OX352996:1759416-1759676 [Streptococcus suis]
MEAIVYSHFRNHLKDYMKKVNDEFEPLVVVNKNPEEDIVVLSKSEWDSLQETLAVARNTYLSQKVLRGMAKVKTGQTQER
NLIEAD

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K1SXY6

Antitoxin

Source ID Structure
AlphaFold DB A0A0K2E7Z9

References